Clone Name | rbasd21m06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SAPKA_ORYSA (Q75H77) Serine/threonine-protein kinase SAPK10 (EC ... | 40 | 0.001 | 2 | SAPK9_ORYSA (Q75V57) Serine/threonine-protein kinase SAPK9 (EC 2... | 39 | 0.002 | 3 | SAPK8_ORYSA (Q7Y0B9) Serine/threonine-protein kinase SAPK8 (EC 2... | 39 | 0.002 | 4 | CTR1_OCTVU (Q7YW31) Cephalotocin receptor 1 (OT/VP superfamily p... | 29 | 2.4 | 5 | TMM28_HUMAN (O75949) Transmembrane protein 28 (TED protein) | 29 | 3.2 |
---|
>SAPKA_ORYSA (Q75H77) Serine/threonine-protein kinase SAPK10 (EC 2.7.11.1)| (Osmotic stress/abscisic acid-activated protein kinase 10) Length = 362 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 382 DLDSDADLDVESSGEIVYAM 323 DLDSD DLDVESSGEIVYAM Sbjct: 343 DLDSDPDLDVESSGEIVYAM 362
>SAPK9_ORYSA (Q75V57) Serine/threonine-protein kinase SAPK9 (EC 2.7.11.1)| (Osmotic stress/abscisic acid-activated protein kinase 9) Length = 361 Score = 39.3 bits (90), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -1 Query: 382 DLDSDADLDVESSGEIVYAM 323 D+DSD DLD+ESSGEIVYAM Sbjct: 342 DMDSDLDLDIESSGEIVYAM 361
>SAPK8_ORYSA (Q7Y0B9) Serine/threonine-protein kinase SAPK8 (EC 2.7.11.1)| (Osmotic stress/abscisic acid-activated protein kinase 8) Length = 371 Score = 39.3 bits (90), Expect = 0.002 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 382 DLDSDADLDVESSGEIVYAM 323 DLDSD+D+DV+SSGEIVYAM Sbjct: 352 DLDSDSDIDVDSSGEIVYAM 371
>CTR1_OCTVU (Q7YW31) Cephalotocin receptor 1 (OT/VP superfamily peptide| receptor-1) (OC/CE-R 1) Length = 397 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/51 (25%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 305 SHIS*PKDGQDTRGRD-RYLEATAEVRLLMLDSPQMLLCCCFCCWSLYFRC 156 SH++ +D G+ Y + ++ + ++ CCF CWS +F C Sbjct: 264 SHLARGFSEEDMEGQSVNYNRGISRAKVRSVALTLSVVACCFICWSPFFVC 314
>TMM28_HUMAN (O75949) Transmembrane protein 28 (TED protein)| Length = 473 Score = 28.9 bits (63), Expect = 3.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 215 DSPQMLLCCCFCCWS 171 D+ + +CCC CCW+ Sbjct: 12 DAAALTICCCCCCWA 26 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,999,406 Number of Sequences: 219361 Number of extensions: 787336 Number of successful extensions: 1860 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1856 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)