Clone Name | rbasd21l05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YDT2_SCHPO (O14207) Hypothetical protein C6B12.02c in chromosome I | 29 | 7.7 | 2 | PYRG_METKA (Q8TYT7) CTP synthase (EC 6.3.4.2) (UTP--ammonia liga... | 29 | 7.7 |
---|
>YDT2_SCHPO (O14207) Hypothetical protein C6B12.02c in chromosome I| Length = 1888 Score = 28.9 bits (63), Expect = 7.7 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 13/73 (17%) Frame = +1 Query: 64 HRRQSRKIRLPS-----------LNIVTNMEVWVQN--FRALGTKRILNLIL*VAPDLSN 204 H+ + +K+ LPS L VT +++W + F R LN+I APD+S Sbjct: 1802 HKSRKKKLVLPSQVEQEEEYWSGLMEVT-IQIWKHDKGFLEPELDRFLNVICSYAPDMSG 1860 Query: 205 SPSTA*CIQEKLG 243 P+ C +K+G Sbjct: 1861 LPTKIKCFLDKIG 1873
>PYRG_METKA (Q8TYT7) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 535 Score = 28.9 bits (63), Expect = 7.7 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -2 Query: 475 LEKHRHEYGLKKXILHVLSDRMNEAGFSRPEGYLYPYPIKPGPYFI 338 LE+HRH Y + + L D P+G + + PYF+ Sbjct: 458 LERHRHRYEVNPSYVRELEDHGLRFSGHSPDGRMEALELPDHPYFV 503 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,193,019 Number of Sequences: 219361 Number of extensions: 1431932 Number of successful extensions: 3199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3199 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)