>CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel alpha-1C subunit|
           (Voltage-gated calcium channel alpha subunit Cav1.2)
           (Calcium channel, L type, alpha-1 polypeptide, isoform
           1, cardiac muscle) (Smooth muscle calcium channel
           blocker receptor)
          Length = 2171

 Score = 28.5 bits (62), Expect = 5.4
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 31  IQINTQSTCSYTLIHDVQV-HMHISXDGQTXG 123
           +   T+STC  T++H+ Q+ H +IS  G   G
Sbjct: 20  LSAETESTCKGTVVHEAQLNHFYISPGGSNYG 51


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,423,081
Number of Sequences: 219361
Number of extensions: 143393
Number of successful extensions: 566
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 562
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 566
length of database: 80,573,946
effective HSP length: 22
effective length of database: 75,748,004
effective search space used: 1817952096
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)