>YDT2_SCHPO (O14207) Hypothetical protein C6B12.02c in chromosome I|
          Length = 1888

 Score = 28.9 bits (63), Expect = 9.3
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 13/73 (17%)
 Frame = +1

Query: 121  HRRQSRKIRLPS-----------LNIVTNMEVWVQN--FRALGTKRILNLIL*VAPDLSN 261
            H+ + +K+ LPS           L  VT +++W  +  F      R LN+I   APD+S 
Sbjct: 1802 HKSRKKKLVLPSQVEQEEEYWSGLMEVT-IQIWKHDKGFLEPELDRFLNVICSYAPDMSG 1860

Query: 262  SPSTA*CIQEKLG 300
             P+   C  +K+G
Sbjct: 1861 LPTKIKCFLDKIG 1873


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 75,520,689
Number of Sequences: 219361
Number of extensions: 1536661
Number of successful extensions: 3314
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3272
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3314
length of database: 80,573,946
effective HSP length: 105
effective length of database: 57,541,041
effective search space used: 4142954952
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)