Clone Name | rbasd21g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CML1_RAT (O35786) Chemokine receptor-like 1 (G-protein coupled r... | 35 | 0.11 | 2 | ADA20_HUMAN (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disinteg... | 31 | 2.7 | 3 | CY1_KLULA (Q00988) Cytochrome c1, heme protein, mitochondrial pr... | 29 | 7.8 |
---|
>CML1_RAT (O35786) Chemokine receptor-like 1 (G-protein coupled receptor DEZ)| (G-protein coupled chemoattractant-like receptor) Length = 371 Score = 35.4 bits (80), Expect = 0.11 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +1 Query: 313 IWLRQHGSLHRHYHQTWLPFSWLSWQPSPS--SGSQERASGWSACCQSLTLVSPDHLRHS 486 +W + H S+ Y + + WLS + PS G + G C + +L +P+ HS Sbjct: 143 VWSQNHRSVRLAYMTCVVVWVWLSSESPPSLVFGHVSTSHGKITCFNNFSLAAPEPFSHS 202 Query: 487 DHPQ 498 HP+ Sbjct: 203 THPR 206
>ADA20_HUMAN (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 20) Length = 726 Score = 30.8 bits (68), Expect = 2.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 168 NIWKNYEVQNLCEWEMASGFYKNALGGMMPISQYK*ACHN 287 +IWKNY + N + ++A F K+ G + ++ K C N Sbjct: 280 SIWKNYNLNNRLQHDVAHLFIKDTQGMKLGVAYVKGICQN 319
>CY1_KLULA (Q00988) Cytochrome c1, heme protein, mitochondrial precursor| Length = 292 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 323 DSMEAFIVTITKHGCHFHGYLGSHLPPLE 409 DS+ A +T +HG H GY SH PLE Sbjct: 40 DSLTADAMTAAEHGLHAPGYGWSHNGPLE 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,614,478 Number of Sequences: 219361 Number of extensions: 1617771 Number of successful extensions: 3763 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3763 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)