Clone Name | rbasd21g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CP4P1_DROME (Q9V558) Cytochrome P450 4p1 (EC 1.14.-.-) (CYPIVP1) | 29 | 2.8 | 2 | SYH_CORJK (Q4JVE8) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histi... | 28 | 4.9 | 3 | NPP17_CAEEL (Q93454) Nucleoporin-17 (Nuclear pore complex protei... | 28 | 6.3 | 4 | EFTU_CYAPA (P17245) Elongation factor Tu (EF-Tu) | 28 | 8.3 |
---|
>CP4P1_DROME (Q9V558) Cytochrome P450 4p1 (EC 1.14.-.-) (CYPIVP1)| Length = 513 Score = 29.3 bits (64), Expect = 2.8 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 22 KLRGSSTIPDYFFSTAVQTSDITSSKDSFTSASN--TLGLVA-LLHPFLESGLLITFGK 189 K G+S I +Y F A+ S ++ + N T GLV LHPFL +GLL + GK Sbjct: 78 KEMGTSYI-EYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTSTGK 135
>SYH_CORJK (Q4JVE8) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 443 Score = 28.5 bits (62), Expect = 4.9 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +1 Query: 13 RFYKLRGSSTIPDYFFSTAVQTSDITSSKDSFTSASNTLGLVALLHPFLESGLLITFGKG 192 +F L +PDY T+ + + KD+FTSA++ G + P E L G G Sbjct: 18 KFKALSAPKGVPDYVPPTSAEFKAV---KDAFTSAAHAAGYEHVELPIFEETSLFARGVG 74
>NPP17_CAEEL (Q93454) Nucleoporin-17 (Nuclear pore complex protein 17) (CeRAE1)| Length = 373 Score = 28.1 bits (61), Expect = 6.3 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 12/60 (20%) Frame = +1 Query: 67 AVQTSDITSSKDSFT-----SASNTLGLVAL-------LHPFLESGLLITFGKGGRVPLW 210 AVQ D+ + KD+FT SA G + HP + G L+T G GR +W Sbjct: 248 AVQYVDVANPKDNFTFKCHRSAELVNGFQEIYAVNDICFHP--QHGTLVTIGSDGRYSMW 305
>EFTU_CYAPA (P17245) Elongation factor Tu (EF-Tu)| Length = 409 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 12/55 (21%) Frame = +1 Query: 70 VQTSDITSSKDSFTSASNTLG-----------LVALLHPF-LESGLLITFGKGGR 198 V+T+D+T S D+FT+ + V+L+HP +E G+ +GGR Sbjct: 343 VRTTDVTGSIDAFTADDGSNAEMVMPGDRIKMTVSLVHPIAIEQGMRFAIREGGR 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,711,731 Number of Sequences: 219361 Number of extensions: 607852 Number of successful extensions: 1659 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1658 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)