| Clone Name | rbasd21f21 |
|---|---|
| Clone Library Name | barley_pub |
>SIP1_HUMAN (O60315) Zinc finger homeobox protein 1b (Smad-interacting protein 1)| (SMADIP1) Length = 1214 Score = 36.2 bits (82), Expect = 0.086 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = -1 Query: 464 RDREFENEDWLAEQCRRDGPEEWRREMFAAAIEVMGERPETYRDEWDGGDY 312 ++ E E ED + R+DG EE+ E + + M PET RDE + GD+ Sbjct: 1138 KEHEKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDH 1188
>FMO2_PONPY (Q5REK0) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 35.4 bits (80), Expect = 0.15 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ WV + G LPSE MM D+ Sbjct: 378 FPTAELQARWVTRVFKGLCSLPSERTMMMDI 408
>FMO2_PANTR (Q8HZ70) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 35.4 bits (80), Expect = 0.15 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ WV + G LPSE MM D+ Sbjct: 378 FPTAELQARWVTRVFKGLCSLPSERTMMMDI 408
>FMO2_MACMU (Q28505) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 35.4 bits (80), Expect = 0.15 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ WV + G LPSE MM D+ Sbjct: 378 FPTAELQARWVTRVFKGLCHLPSERTMMMDI 408
>FMO2_HUMAN (Q99518) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 35.4 bits (80), Expect = 0.15 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ WV + G LPSE MM D+ Sbjct: 378 FPTAELQARWVTRVFKGLCSLPSERTMMMDI 408
>FMO2_GORGO (Q8HZ69) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 35.4 bits (80), Expect = 0.15 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ WV + G LPSE MM D+ Sbjct: 378 FPTAELQARWVTRVFKGLCSLPSERTMMMDI 408
>FMO2_CAVPO (P36366) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 35.0 bits (79), Expect = 0.19 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ W + G LPSE+ MM D+ Sbjct: 378 FPTVELQARWATRVFKGLCHLPSEKTMMEDI 408
>FMO3_PANTR (Q7YS44) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) Length = 531 Score = 35.0 bits (79), Expect = 0.19 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQS W A ++ G LPS E+MM D+ Sbjct: 379 PTVDLQSRWAAQVIKGTCTLPSMEDMMNDI 408
>FMO3_MACMU (Q8SPQ7) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) Length = 531 Score = 35.0 bits (79), Expect = 0.19 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQS W A ++ G LPS E+MM D+ Sbjct: 379 PTVDLQSRWAARVIKGTCTLPSMEDMMNDI 408
>FMO3_HUMAN (P31513) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) (FMO form 2) (FMO II) Length = 531 Score = 35.0 bits (79), Expect = 0.19 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQS W A ++ G LPS E+MM D+ Sbjct: 379 PTVDLQSRWAAQVIKGTCTLPSMEDMMNDI 408
>FMO2_RABIT (P17635) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) (FMO 1B1) Length = 534 Score = 34.7 bits (78), Expect = 0.25 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ W + G LPS+E MM D+ Sbjct: 378 FPTVELQARWATRVFKGLCSLPSKETMMADI 408
>SIP1_MOUSE (Q9R0G7) Zinc finger homeobox protein 1b (Smad-interacting protein 1)| Length = 1215 Score = 34.7 bits (78), Expect = 0.25 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -1 Query: 464 RDREFENEDWLAEQCRRDGPEEWRREMFAAAIEVMGERPETYRDEWDGGDY 312 ++ E E E+ + RRDG EE E + + M PET RDE + GD+ Sbjct: 1138 KEHEKEGEEGYGKLRRRDGDEEEEEEEEESENKSMDTDPETIRDEEETGDH 1188
>FMO2_RAT (Q6IRI9) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) Length = 534 Score = 33.9 bits (76), Expect = 0.43 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ W + G +LPSE MM D+ Sbjct: 378 FPTVELQARWATRVFKGVCRLPSETTMMADI 408
>FMO2_MOUSE (Q8K2I3) Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC| 1.14.13.8) (Pulmonary flavin-containing monooxygenase 2) (FMO 2) (Dimethylaniline oxidase 2) Length = 534 Score = 33.9 bits (76), Expect = 0.43 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 617 FPLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 FP ELQ+ W + G LPSE MM D+ Sbjct: 378 FPTVELQARWATRVFKGLCSLPSETTMMADI 408
>FMO5_CAVPO (P49109) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) Length = 532 Score = 33.9 bits (76), Expect = 0.43 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDVTAFYSRLGAR 495 P+ ELQ W + G LPS+ EMM ++T + R Sbjct: 379 PISELQGRWAVQVFKGLKTLPSQSEMMAEITKAQEEIAKR 418
>FMO5_RABIT (Q04799) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) (FMO 1C1) (FMO form 3) Length = 532 Score = 33.1 bits (74), Expect = 0.73 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDVTAFYSRLGAR 495 P+ ELQ+ W + G LPS+ EMM +++ ++ R Sbjct: 379 PISELQARWATLVFKGLKTLPSQSEMMTEISQVQEKMAKR 418
>FMO5_RAT (Q8K4C0) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) Length = 532 Score = 32.3 bits (72), Expect = 1.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDVTAFYSRLGAR 495 P+ ELQ W + G +LPS+ EMM ++ + R Sbjct: 379 PISELQGRWATQVFKGLKKLPSQSEMMAEINKTREEMAKR 418
>FMO5_MOUSE (P97872) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) Length = 532 Score = 32.3 bits (72), Expect = 1.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDVTAFYSRLGAR 495 P+ ELQ W + G +LPS+ EMM ++ + R Sbjct: 379 PISELQGRWATQVFKGLKKLPSQSEMMAEINKAREEMAKR 418
>IASPP_HUMAN (Q8WUF5) RelA-associated inhibitor (Inhibitor of ASPP protein)| (Protein iASPP) (PPP1R13B-like protein) (NFkB-interacting protein 1) Length = 828 Score = 32.3 bits (72), Expect = 1.2 Identities = 20/54 (37%), Positives = 24/54 (44%) Frame = -3 Query: 618 FSTIRAPEPLGGRHSVRAIPAPVRGGDDARRDGLLLTFGRSRMAPKIHPQTARS 457 +S+ PEP G R S R A DG FGRS AP +HP + S Sbjct: 70 YSSSSIPEPFGSRGSPRK----------AATDGADTPFGRSESAPTLHPYSPLS 113
>FMO3_MOUSE (P97501) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) Length = 534 Score = 32.0 bits (71), Expect = 1.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P+ +LQ+ W A ++ G LPS +MM D+ Sbjct: 380 PITDLQARWAAQVIKGTCTLPSVNDMMDDI 409
>FMO5_HUMAN (P49326) Dimethylaniline monooxygenase [N-oxide-forming] 5 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 5) (FMO 5) (Dimethylaniline oxidase 5) Length = 532 Score = 32.0 bits (71), Expect = 1.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDVTAFYSRLGAR 495 P+ ELQ W + G LPS+ EMM +++ + R Sbjct: 379 PISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKR 418
>FMO3_BOVIN (Q8HYJ9) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) Length = 532 Score = 31.6 bits (70), Expect = 2.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQS W ++ G LPS ++MM D+ Sbjct: 380 PTTDLQSRWAVQVIKGTCPLPSVKDMMNDI 409
>IASPP_MOUSE (Q5I1X5) RelA-associated inhibitor (Inhibitor of ASPP protein)| (Protein iASPP) (PPP1R13B-like protein) (NFkB-interacting protein 1) Length = 824 Score = 31.2 bits (69), Expect = 2.8 Identities = 19/54 (35%), Positives = 24/54 (44%) Frame = -3 Query: 618 FSTIRAPEPLGGRHSVRAIPAPVRGGDDARRDGLLLTFGRSRMAPKIHPQTARS 457 +ST PE G R S + I DG+ FGRS AP +HP + S Sbjct: 70 YSTSPVPEHFGSRGSPQKIAT----------DGIEARFGRSESAPSLHPYSPLS 113
>PNT1_YEAST (P38969) Pentamidine resistance factor, mitochondrial precursor| Length = 423 Score = 30.8 bits (68), Expect = 3.6 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = +1 Query: 133 IIFVFTDRYVILFAFWVPQPPFHCLSRRHFDQ------EGTTINQGQRGAG 267 ++F+F + V++F F+ P++CL+ + + +GTT QG G G Sbjct: 204 LVFIFEEVSVLIFTFFPRVCPYNCLTPGGYKKLSNSYIKGTTSTQGNYGLG 254
>FMO3_RABIT (P32417) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) (FMO 1D1) (FMO form 2) (FMO II) Length = 530 Score = 30.0 bits (66), Expect = 6.2 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQ+ W A ++ G LP ++MM D+ Sbjct: 379 PTTDLQARWAAQVIKGTCTLPPVKDMMNDI 408
>FMO3_RAT (Q9EQ76) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) Length = 531 Score = 29.6 bits (65), Expect = 8.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQ+ W A ++ G LPS +MM D+ Sbjct: 380 PTTDLQARWAAQVIRGTCILPSVNDMMDDI 409
>FMO3_CANFA (Q95LA1) Dimethylaniline monooxygenase [N-oxide-forming] 3 (EC| 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) (Dimethylaniline oxidase 3) Length = 531 Score = 29.6 bits (65), Expect = 8.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 614 PLFELQSHWVAGILSGRFQLPSEEEMMRDV 525 P +LQ+ W ++ G LPS +MM D+ Sbjct: 379 PTTDLQARWAVQVIKGTCTLPSVTDMMNDI 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,360,398 Number of Sequences: 219361 Number of extensions: 1828542 Number of successful extensions: 4953 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 4795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4952 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6086476506 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)