Clone Name | rbasd20p11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MAN2_DROME (Q24451) Alpha-mannosidase 2 (EC 3.2.1.114) (Alpha-ma... | 28 | 5.0 |
---|
>MAN2_DROME (Q24451) Alpha-mannosidase 2 (EC 3.2.1.114) (Alpha-mannosidase II)| (Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase) (MAN II) (Golgi alpha-mannosidase II) (AMAN II) Length = 1108 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -2 Query: 163 QLTDDGPHIKCHXSFVNSXIALGFPSPXSFLFVPKNVCS 47 QLT D PH+ H F+ + ++LF+P S Sbjct: 761 QLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPAS 799 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,951,623 Number of Sequences: 219361 Number of extensions: 300740 Number of successful extensions: 440 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)