Clone Name | rbasd21c23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UN13C_HUMAN (Q8NB66) Unc-13 homolog C (Munc13-3) (Fragment) | 35 | 0.25 | 2 | UN13C_RAT (Q62770) Unc-13 homolog C (Munc13-3) | 33 | 0.94 | 3 | SPRT_YERPE (Q8ZHG6) Protein sprT | 30 | 6.1 |
---|
>UN13C_HUMAN (Q8NB66) Unc-13 homolog C (Munc13-3) (Fragment)| Length = 1190 Score = 34.7 bits (78), Expect = 0.25 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 6/61 (9%) Frame = -1 Query: 605 CHEIYSQITKESKPAD---EVPGSATERSQ---KLLFPSKNVSDEDLIAVSEVFGQYQQK 444 CHE+YSQ+T SK D E G T+ +L+ + DED A + V Q+ Q+ Sbjct: 537 CHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE 596 Query: 443 L 441 L Sbjct: 597 L 597
>UN13C_RAT (Q62770) Unc-13 homolog C (Munc13-3)| Length = 2204 Score = 32.7 bits (73), Expect = 0.94 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = -1 Query: 605 CHEIYSQITKESKPAD---EVPGSATERSQ---KLLFPSKNVSDEDLIAVSEVFGQYQQK 444 CHE+YSQ+ SK D E G T+ +L+ + DED A + V Q+ Q+ Sbjct: 1551 CHELYSQLIDPSKKQDVPREEQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE 1610 Query: 443 L 441 L Sbjct: 1611 L 1611
>SPRT_YERPE (Q8ZHG6) Protein sprT| Length = 170 Score = 30.0 bits (66), Expect = 6.1 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 3/64 (4%) Frame = +1 Query: 226 WVAYHTTRCSASRTEQILMKSFTQNFDNYSCRPDVEPQFIRRTCDV---KPQFIRRTCGV 396 W+ + ASRT Q + S NY C+ IRR V + ++ R CG Sbjct: 101 WMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHSLTIRRHNKVLRGESEYRCRQCGE 160 Query: 397 KPQF 408 K QF Sbjct: 161 KLQF 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,200,898 Number of Sequences: 219361 Number of extensions: 1793838 Number of successful extensions: 4596 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4596 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)