Clone Name | rbasd21b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.1... | 31 | 2.1 | 2 | TRPB_PROMP (Q7TUH0) Tryptophan synthase beta chain (EC 4.2.1.20) | 30 | 3.5 | 3 | 5HT6R_RAT (P31388) 5-hydroxytryptamine 6 receptor (5-HT-6) (Sero... | 30 | 4.6 | 4 | REP7_FBNY1 (Q9WIK0) Replication-associated protein 7 (EC 2.7.7.-... | 29 | 6.0 |
---|
>DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.107)| (Diglyceride kinase 3) (DGK-3) (DAG kinase 3) Length = 812 Score = 30.8 bits (68), Expect = 2.1 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 231 GLLGFRFCRWCNKGPPKVPPACHVHHRPESCLRGRCDLG 347 G+ + CRWC+ +VHHR S L CDLG Sbjct: 349 GVFQGKGCRWCHN---------YVHHRCMSALAQECDLG 378
>TRPB_PROMP (Q7TUH0) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 414 Score = 30.0 bits (66), Expect = 3.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 69 YVNNLAHLLQTYINPHVTTYNCRRITHKM*PKQIQCKSSPFW 194 +VN L HLL+TY+ Y +R+T Q + +S W Sbjct: 57 FVNELNHLLKTYVGRETPLYEAKRLTEHY---QTKTSTSRIW 95
>5HT6R_RAT (P31388) 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin| receptor 6) (ST-B17) Length = 436 Score = 29.6 bits (65), Expect = 4.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 29 SQGPTIYEYDTRFIRKQFGTFTPNIHQPPCYNLQLPP 139 + P IY R ++ G F P +H PP + LPP Sbjct: 314 TMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPP 350
>REP7_FBNY1 (Q9WIK0) Replication-associated protein 7 (EC 2.7.7.-) (EC| 3.1.21.-) (EC 3.6.1.-) (ATP-dependent helicase C7) (Rep7) Length = 283 Score = 29.3 bits (64), Expect = 6.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 51 SYMVGPWEYGVWVSN 7 S + GPWEYG W+S+ Sbjct: 85 SAIAGPWEYGTWISS 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,643,399 Number of Sequences: 219361 Number of extensions: 1607299 Number of successful extensions: 4132 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4130 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)