ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd20m02 |
|---|---|
| Clone Library Name | barley_pub |
>YDA6_SCHPO (Q10348) Putative endonuclease C1F12.06c (EC 3.1.-.-)| Length = 252 Score = 37.7 bits (86), Expect = 0.029 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P GFGLACHLGVL +LP +G Sbjct: 121 PVGFGLACHLGVLLNLPVVG 140
>NFI_METCA (Q60CT7) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 222 Score = 35.4 bits (80), Expect = 0.14 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P FG+ACHLGVL +PTIG Sbjct: 121 PRRFGIACHLGVLTGIPTIG 140
>NFI_NOCFA (Q5YQW3) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 226 Score = 33.5 bits (75), Expect = 0.54 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P FGLACH+GV LPTIG Sbjct: 118 PRRFGLACHVGVRTGLPTIG 137
>NFI_STRAW (Q82MH6) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 229 Score = 33.1 bits (74), Expect = 0.71 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P FGLA HLGVL LPTIG Sbjct: 121 PRRFGLASHLGVLTGLPTIG 140
>NFI_STRCO (Q9X7N2) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 233 Score = 33.1 bits (74), Expect = 0.71 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P FGLA HLGVL LPTIG Sbjct: 123 PRRFGLASHLGVLTGLPTIG 142
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 329 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 436 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 329 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 436 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>NFI_THET8 (Q5SIM2) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 226 Score = 30.8 bits (68), Expect = 3.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P G G+A HLGV DLP++G Sbjct: 117 PRGLGIASHLGVHLDLPSVG 136
>NFI_THET2 (Q72IZ9) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 226 Score = 30.8 bits (68), Expect = 3.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P G G+A HLGV DLP++G Sbjct: 117 PRGLGIASHLGVHLDLPSVG 136
>NFI_PYRKO (Q5JI47) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 197 Score = 30.8 bits (68), Expect = 3.5 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P G+GLA H+G++ +PTIG Sbjct: 108 PRGYGLASHIGLVLGIPTIG 127
>NFI_PYRHO (O58394) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 211 Score = 30.0 bits (66), Expect = 6.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P G+GLA H+GV+ PTIG Sbjct: 102 PRGYGLASHIGVVLRKPTIG 121
>NFI_ANASP (Q8YPV5) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 221 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P G+A HLGVL ++PTIG Sbjct: 119 PRRLGIASHLGVLLNIPTIG 138
>NFI_GLOVI (Q7NDJ2) Endonuclease V (EC 3.1.21.7) (Deoxyinosine 3'endonuclease)| (Deoxyribonuclease V) (DNase V) Length = 246 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 279 PSGFGLACHLGVLADLPTIG 220 P G+A HLG+ DLPTIG Sbjct: 127 PRRLGIASHLGLFLDLPTIG 146
>SELD_CAMJE (Q9PMF9) Selenide, water dikinase (EC 2.7.9.3) (Selenophosphate| synthetase) (Selenium donor protein) Length = 340 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 234 GLQGHRDDMLNQNLRVEMMSIDLPHHDEISQ 326 GL GH +MLN+N+ E+ +LP D + + Sbjct: 229 GLLGHLKEMLNKNISFEIFESELPFLDGVKE 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,112,019 Number of Sequences: 219361 Number of extensions: 1771773 Number of successful extensions: 3488 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3488 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
