Clone Name | rbasd20l14 |
---|---|
Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 77.4 bits (189), Expect = 8e-15 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESGKA 206 EV KE PD YVRIIGF NMRQVQCVSFIAFKPPGC ESGKA Sbjct: 73 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 77.4 bits (189), Expect = 8e-15 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESGKA 206 EV KE PD YVRIIGF NMRQVQCVSFIAFKPPGC ESGKA Sbjct: 134 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESGKA 206 EV KE PD YVR+IGF NMRQVQCVSFIAF+PPGC ESGKA Sbjct: 135 EVKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 74.7 bits (182), Expect = 5e-14 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESGKA 206 EV KE PD YVR+IGF N+RQVQCVSFIAF+PPGC ESGKA Sbjct: 134 EVKKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 67.8 bits (164), Expect = 7e-12 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESGKA 206 EV KE PD Y RIIGF NMRQVQ VSFIA KPPGC ESGKA Sbjct: 135 EVRKEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 61.6 bits (148), Expect = 5e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESG 212 E K PD +VRIIGF N+RQVQ +SFIA+KPPGC ESG Sbjct: 135 EAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 61.2 bits (147), Expect = 6e-10 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESG 212 E K PD ++RIIGF N+RQVQ +SFIA+KPPGC ESG Sbjct: 135 EAKKAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 56.2 bits (134), Expect = 2e-08 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E+ K PD Y RIIGF N+RQVQC+SF+A+KPPG Sbjct: 148 ELIKHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 54.7 bits (130), Expect = 6e-08 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N RQVQCVSFIAFKPPG Sbjct: 146 EAKKAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E KE P ++RIIGF N RQVQC+SFIA+KPP E+ Sbjct: 144 ECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E KE P ++RIIGF N RQVQC+SFIA+KPP E+ Sbjct: 144 ECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 53.9 bits (128), Expect = 1e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P+ ++RIIGF N+RQVQC+SFIA+KPPG Sbjct: 146 EAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 53.9 bits (128), Expect = 1e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P+ ++RIIGF N+RQVQC+SFIA+KPPG Sbjct: 146 EAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E KE P+ ++RIIGF N RQVQC+SFIA+KPP ++ Sbjct: 45 ECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTDA 82
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E KE P+ ++RIIGF N RQVQC+SFIA+KPP Sbjct: 144 ECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 53.1 bits (126), Expect = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E KE PD ++R+IGF N+RQVQC+SFIA+KP Sbjct: 148 EAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E KE P ++RIIGF N RQVQC+SFIA+KPP ++ Sbjct: 144 ECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTDA 181
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 52.4 bits (124), Expect = 3e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXESG 212 E K PD +VRIIGF N+RQVQ +SFIA+ PGC ESG Sbjct: 133 EAKKAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 52.4 bits (124), Expect = 3e-07 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P+ ++R+IGF N+RQVQC+SFI KPPG Sbjct: 146 ECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 KE P+ ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 151 KEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 51.6 bits (122), Expect = 5e-07 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K PD + R+IGF N++Q QCVSFIA+KPPG Sbjct: 135 EAIKSYPDAFHRVIGFDNIKQTQCVSFIAYKPPG 168
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 51.6 bits (122), Expect = 5e-07 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E KE P+ +RIIGF N RQVQC+SFIA+KPP ++ Sbjct: 144 ECKKEYPNALIRIIGFDNNRQVQCISFIAYKPPSFTDA 181
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 51.6 bits (122), Expect = 5e-07 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E P+ ++RIIGF N+RQVQC+SFIA+KPPG Sbjct: 144 EAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 51.2 bits (121), Expect = 6e-07 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E+ K PD Y RIIGF N+RQVQC+SF+A+KP G Sbjct: 148 EMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKG 181
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 51.2 bits (121), Expect = 6e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N RQVQC+SFIA+KP G Sbjct: 146 ECKKEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 149 EAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 149 EAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 50.8 bits (120), Expect = 8e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P +VRIIGF N+RQVQC+SFIA+KP G Sbjct: 147 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 50.8 bits (120), Expect = 8e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQCVSFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 50.8 bits (120), Expect = 8e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K PD ++RIIGF N+RQVQC+SFIA+KP Sbjct: 146 EAKKAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 50.8 bits (120), Expect = 8e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P +VRIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 50.8 bits (120), Expect = 8e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P +VRIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 50.8 bits (120), Expect = 8e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P +VRIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 50.8 bits (120), Expect = 8e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P +VRIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N RQVQCVSFIA+KP G Sbjct: 148 EAKKAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 147 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 147 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E E P+ ++RIIGF N RQVQC+SFIA+KPP Sbjct: 144 ECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 147 ECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E E P+ ++RIIGF N RQVQC+SFIA+KPP Sbjct: 144 ECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E K P ++RIIGF N RQVQC+SFIA+KPP Sbjct: 148 EASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+SFIA KP G Sbjct: 144 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+SFIA KP G Sbjct: 144 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P+ ++RIIGF + RQVQCVSFIA+KP G Sbjct: 146 ECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ ++RIIGF N+RQVQCVSFIA+KP Sbjct: 147 EAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ ++RIIGF N+RQVQCVSFIA+KP Sbjct: 150 EAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ ++RIIGF N+RQVQCVSFIA+KP Sbjct: 146 EAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 50.1 bits (118), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ ++RIIGF N+RQVQC+SFIA+KP Sbjct: 146 EAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E P+ ++RIIGF N+RQVQC+SFIA+KPP Sbjct: 144 EAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ ++RIIGF N+RQVQC+SFIA+KP Sbjct: 147 EAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 EV K PD +VR IGF + R+VQC+SFIA+KP G Sbjct: 89 EVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E P+ ++RIIGF N+RQVQC+SFIA+KPP Sbjct: 144 EAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 E P+ ++RIIGF N+RQVQC+SFIA+KPP Sbjct: 144 EAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K P ++RIIGF N RQVQ +SFIA+KPPG Sbjct: 148 ECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ +VRIIGF N RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ +VRIIGF N RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ +VRIIGF N RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ +VRIIGF N RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ +VRIIGF N RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 48.9 bits (115), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ +VRIIGF N RQVQC+SFIA+KP Sbjct: 141 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E P ++RIIGF N+RQVQC+SFIA+KP G Sbjct: 147 EAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 48.5 bits (114), Expect = 4e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E KE P ++RIIGF N+RQVQC+SFIA KP Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ + RIIGF N+RQVQC+SFIA+KP Sbjct: 144 EAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P ++RIIGF N+RQVQC+SFIA+KP Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 48.1 bits (113), Expect = 5e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E PD +VRIIGF N RQVQC+SFIA+KP Sbjct: 145 ECKNAYPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 48.1 bits (113), Expect = 5e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P ++RIIGF N RQVQCVSFIA+KP Sbjct: 149 EAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E K PD + RIIGF N RQVQC+SF+ +KP G Sbjct: 144 ECSKAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPG 227 E KE P ++RIIGF N+RQVQC+ FIA +P G Sbjct: 144 ECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E KE P ++R+IGF N+RQVQCVSFI KP Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E KE P ++R+IGF N+RQVQCVSFI KP Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E KE P ++R+IGF N+RQVQCVSFI KP Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 46.2 bits (108), Expect = 2e-05 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 316 EXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E PD ++RIIGF N+RQVQC+SFIA P Sbjct: 150 EYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 45.8 bits (107), Expect = 3e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P+ ++R+IGF N+RQVQC+SFI KP Sbjct: 155 ECAKAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E KE P ++R+IGF N+RQVQCVSFI +P Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E E P+ ++RIIGF N+RQVQC+SFIA P Sbjct: 144 ECKAEYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 EV P+ +VR+IGF N+RQVQC+SFIA P Sbjct: 102 EVVAAYPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E K P ++R+IGF N+RQVQC+SFI KP Sbjct: 139 ECAKAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 EV P +VRIIGF N+RQVQC+SFIA P Sbjct: 146 EVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 44.7 bits (104), Expect = 6e-05 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 EV P +VRIIGF N+RQVQC+SFIA P Sbjct: 146 EVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E E P+ Y+R+IGF N++Q Q VSFI KP Sbjct: 75 ECRSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E E D Y+R++GF N++Q Q VSFI +KP Sbjct: 75 ECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E E P+ Y+R++GF N++Q Q VSFI KP Sbjct: 75 ECRTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 36.2 bits (82), Expect = 0.021 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -2 Query: 310 PDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 P+ Y+R++ F N++QVQC+ F+ +P E Sbjct: 129 PNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 35.8 bits (81), Expect = 0.027 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -2 Query: 316 EXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 + P Y+R++GF N++Q Q +SFI KP Sbjct: 79 QYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 301 YVRIIGFXNMRQVQCVSFIAFKP 233 Y+R +GF N RQVQC SFI +P Sbjct: 156 YIRCLGFDNTRQVQCASFIVHQP 178
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 35.4 bits (80), Expect = 0.036 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E E D Y+R+ GF N++Q Q VSFI +P Sbjct: 76 ECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 35.0 bits (79), Expect = 0.047 Identities = 11/29 (37%), Positives = 22/29 (75%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 ++ P+ Y+R++ F ++RQVQ + F+ +KP Sbjct: 77 QQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 34.7 bits (78), Expect = 0.061 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 K PD YVR++ F N +QVQ + F+ +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 34.7 bits (78), Expect = 0.061 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 K PD YVR++ F N +QVQ + F+ +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 1091 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 803 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 660 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 516 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 373 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 34.3 bits (77), Expect = 0.080 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 229 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 31.2 bits (69), Expect = 0.68 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 E + P YVR+ F +++QVQ +SF+ +P Sbjct: 1235 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 328 EVXKEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXES 215 E + P YVR+ F +++QVQ +SF+ +P G S Sbjct: 948 ECRRAYPQCYVRL-AFDSVKQVQVISFVVQRPSGSSSS 984
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 33.9 bits (76), Expect = 0.10 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 44 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 131 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +PP + Sbjct: 84 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 292 IIGFXNMRQVQCVSFIAFKPPG 227 I+GF N+RQ Q ++FIA+KP G Sbjct: 145 ILGFDNIRQTQWLTFIAYKPAG 166
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPP 230 K PD Y+R++ F RQVQ F+ +PP Sbjct: 142 KAFPDAYIRLVCFDANRQVQISGFLVHRPP 171
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 32.3 bits (72), Expect = 0.30 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 310 PDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 PD Y+R++ F RQVQ F+ +PP + Sbjct: 143 PDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 32.3 bits (72), Expect = 0.30 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 310 PDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 PD Y+R++ F RQVQ F+ +PP + Sbjct: 144 PDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKPPGCXE 218 K PD Y+R++ F RQVQ F+ +P + Sbjct: 133 KAFPDAYIRLVCFDANRQVQISGFLVHRPESATD 166
>CS021_PONPY (Q5RBH3) Protein C19orf21 homolog| Length = 685 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 6/51 (11%) Frame = +2 Query: 50 AFSSHVGX*TWAVHTFLG------TNKKDNGEGKPKAMSELTKLQWHFICG 184 A +H G TWAVH G T + D G+ P+ + +L + +W I G Sbjct: 99 ARDAHQGRPTWAVHPEDGEDEEMKTYRLDAGDAVPRGLCDLERERWAIIQG 149
>AMP1A_ARATH (Q9SLN5) Methionine aminopeptidase 1A (EC 3.4.11.18) (MetAP 1A)| (MAP 1A) (Peptidase M 1A) Length = 398 Score = 30.0 bits (66), Expect = 1.5 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 135 GFPSPLSFLFVPKNVCTA 82 G+PSPL++ F PK+ CT+ Sbjct: 190 GYPSPLNYYFFPKSCCTS 207
>TDCD_ECOL6 (P59244) Propionate kinase (EC 2.7.2.15)| Length = 402 Score = 28.1 bits (61), Expect = 5.7 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = -1 Query: 290 HRIXQHASGXVRQLHRLQATRLXGVRQGINSSLTMGHI*SAIAVL 156 HRI +H +G LHRL G G NSSL + +AVL Sbjct: 302 HRIARHIAGHAASLHRLDGIIFTG-GIGENSSLIRRLVMEHLAVL 345
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFK 236 K P +VRI+G+ N +Q Q S + ++ Sbjct: 87 KRNPHNHVRIVGYDNFKQSQGTSLVVYR 114
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -2 Query: 319 KEXPDXYVRIIGFXNMRQVQCVSFIAFKP 233 + P+ +++IG+ N+RQ Q + + ++P Sbjct: 94 RSNPNHLIKLIGYDNIRQTQGTAMLVYRP 122
>YHFA_SCHPO (O74751) Hypothetical protein C1734.10c in chromosome II| Length = 332 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 186 GPHIKCHCSFVNSDIAL 136 GP+ K HCSF N+++ L Sbjct: 164 GPNFKLHCSFCNAELGL 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,384,522 Number of Sequences: 219361 Number of extensions: 669732 Number of successful extensions: 1460 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 1429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1460 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)