| Clone Name | rbasd20l12 |
|---|---|
| Clone Library Name | barley_pub |
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.8 bits (68), Expect = 0.85 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 49 EQLSRLQQPHAAXPPRSQHNKVHTAHRSHT 138 +Q S+LQ PH+ PP QH + H H+ T Sbjct: 406 QQHSQLQPPHSQHPPPHQHIQHHPNHQHQT 435
>NBR1_PONPY (Q5RC94) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 894 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 362 LSEMGFDDRETNKELLAKNXGSIKRAVMDLIAREKKD 252 L EMGF DR+ N +LL K+ +I + V +L+ D Sbjct: 852 LFEMGFCDRQLNLQLLKKHNYNILQVVTELLQLNNND 888
>NBR1_RAT (Q501R9) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 983 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 362 LSEMGFDDRETNKELLAKNXGSIKRAVMDLIAREKKD 252 L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 941 LFEMGFCDRQLNLRLLRKHNHNILQVVTELLQVNNND 977
>SIN1_SCHPO (Q9P7Y9) Stress-activated map kinase-interacting protein 1| (SAPK-interacting protein 1) Length = 665 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 8/51 (15%) Frame = +1 Query: 58 SRLQQPHAAXPPRSQH--------NKVHTAHRSHTNKSSQXFIGKLRDTLS 186 +++++ AA P +S+H NK H H S T+ SQ ++DTL+ Sbjct: 386 AQIKENQAAYPFKSKHPTSIPEANNKTHIRHTSSTSSQSQKQAQDVKDTLN 436
>NBR1_HUMAN (Q14596) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) (1A1-3B) Length = 966 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 362 LSEMGFDDRETNKELLAKNXGSIKRAVMDLIAREKKD 252 L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 924 LFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND 960
>NBR1_MOUSE (P97432) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) Length = 988 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 362 LSEMGFDDRETNKELLAKNXGSIKRAVMDLIAREKKD 252 L EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 946 LFEMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982
>KNOX3_MAIZE (P56661) Homeobox protein knotted-1-like 3 (Fragment)| Length = 88 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 344 DDRETNKELLAKNXGSIKRAVMDLIAREKKDK 249 DD+E K+LL K G + +L + KKDK Sbjct: 1 DDKELKKQLLRKYSGCLGNLRKELCKKRKKDK 32
>HRP1_YEAST (Q99383) Nuclear polyadenylated RNA-binding protein 4 (Cleavage| factor IB) (CFIB) Length = 534 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = +1 Query: 49 EQLSRLQQPHAAXPPRSQ--HNKVHTAHRSHTNKSSQXFIGKL-----RDTLSRYLGIY 204 + +S+ QQP + PP+ Q K + + +S + FIG L D L Y G Y Sbjct: 124 QTMSQFQQPSSQSPPQQQVTQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKY 182
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 GTEQLSRLQQPHAAXPPRSQHNKVHTAHRSHT 138 G+ QLS L Q H + + +H+ H SH+ Sbjct: 270 GSSQLSELDQYHEQDDDHRETDSIHSCHSSHS 301
>PMEU1_LYCES (Q43143) Pectinesterase U1 precursor (EC 3.1.1.11) (Pectin| methylesterase) (PE) Length = 583 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -2 Query: 133 DFCVRCELYYVVTVVGQLRVVAVIGXVA 50 DFC R + Y+ V L V AVIG VA Sbjct: 13 DFCKRKKKIYLAIVASVLLVAAVIGVVA 40
>FOXJ3_HUMAN (Q9UPW0) Forkhead box protein J3| Length = 622 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 49 EQLSRLQQPHAAXPPRSQHNKVHTAHRSHT 138 +Q S+LQ PH P QH + H H+ T Sbjct: 405 QQHSQLQSPHPQHPSPHQHIQHHPNHQHQT 434 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,288,411 Number of Sequences: 219361 Number of extensions: 695308 Number of successful extensions: 1613 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1613 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)