Clone Name | rbasd20k16 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-as... | 32 | 0.87 | 2 | HSP71_PICAN (P53421) Heat-shock protein 70 1 (HSP72) | 30 | 5.6 | 3 | MT3_BOVIN (P37359) Metallothionein-3 (MT-3) (Metallothionein-III... | 29 | 9.6 |
---|
>KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-associated| protein 15.1) Length = 136 Score = 32.3 bits (72), Expect = 0.87 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = +2 Query: 110 PCQSHYTSALKSGNIGQTKGKYIYMSTSVQVTDASKYCHHRQNRCSPTMTSS 265 PCQ+ YT +L SGNIG G + ST Q N CSPT SS Sbjct: 85 PCQTIYTGSLGSGNIG--LGSFGCGSTGFQSLGCG------SNFCSPTYVSS 128
>HSP71_PICAN (P53421) Heat-shock protein 70 1 (HSP72)| Length = 644 Score = 29.6 bits (65), Expect = 5.6 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 500 HYGGRDFYDSSPHKQANESSRNYKEDNTDGSLATR 396 H GG DF + + ANE R YK+D T A R Sbjct: 226 HLGGEDFDNRLVNHFANEFKRKYKKDLTTNQRALR 260
>MT3_BOVIN (P37359) Metallothionein-3 (MT-3) (Metallothionein-III) (MT-III)| (Growth inhibitory factor) (GIF) Length = 68 Score = 28.9 bits (63), Expect = 9.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 45 SDPVRCSCKRAATFRRTCFCCCPA 116 SDP +C A+ +++C CCPA Sbjct: 17 SDPCKCEGCTCASCKKSCCSCCPA 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,991,552 Number of Sequences: 219361 Number of extensions: 1688693 Number of successful extensions: 4610 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4608 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)