Clone Name | rbasd20i24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COA2_HUMAN (O00763) Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-b... | 28 | 9.0 | 2 | OTC_ASPNG (P11066) Ornithine carbamoyltransferase, mitochondrial... | 28 | 9.0 |
---|
>COA2_HUMAN (O00763) Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta)| [Includes: Biotin carboxylase (EC 6.3.4.14)] Length = 2483 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 323 LSMKLWKCLTFSFSRVTGSITSSSPVSTHRS 415 LS ++ CLTFS+ ++ +T S P++ +S Sbjct: 7 LSCLIFSCLTFSWLKIWEKMTDSKPITKSKS 37
>OTC_ASPNG (P11066) Ornithine carbamoyltransferase, mitochondrial precursor| (EC 2.1.3.3) (OTCase) (Ornithine transcarbamylase) Length = 370 Score = 28.1 bits (61), Expect = 9.0 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 215 RVLRQPTILRR--SSLASEAGAEAVSPFAKRHYL 120 R P LRR SS + A A SPFA RH L Sbjct: 14 RAFHNPPALRRLYSSTSHSAATPATSPFAPRHLL 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,081,643 Number of Sequences: 219361 Number of extensions: 846724 Number of successful extensions: 2751 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2751 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)