Clone Name | rbasd20i07 |
---|---|
Clone Library Name | barley_pub |
>CP2DP_PIG (O46658) Cytochrome P450 2D25 (EC 1.14.14.-) (CYPIID25) (Vitamin| D(3) 25-hydroxylase) Length = 499 Score = 30.0 bits (66), Expect = 7.0 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 263 SGQRWCVGQSLTRCSLRLKLISLLQAALVALPSQEP 156 +G+R C+G+ L R L L +LLQA ++P+ +P Sbjct: 440 AGRRSCLGEPLARMELFLFFTTLLQAFSFSVPTGQP 475
>CP21A_BOVIN (P00191) Cytochrome P450 21 (EC 1.14.99.10) (Cytochrome P450 XXI)| (Steroid 21-hydroxylase) (21-OHase) (P450-C21) (P-450c21) Length = 496 Score = 30.0 bits (66), Expect = 7.0 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = -2 Query: 260 GQRWCVGQSLTRCSLRLKLISLLQAALV------ALPSQEP 156 G R C+G+SL R L + L+ LLQA + ALPS +P Sbjct: 423 GARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQP 463
>POLG_JAEVN (P14403) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 1440 Score = 30.0 bits (66), Expect = 7.0 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = -1 Query: 468 NVHQTVRHGS*FICTCCPSPALRPPQRMSTTKSCWHWSCLKEL------LTRVDVDAASG 307 +V T G CC S +L PP R T CW+ ++ + L R VDA +G Sbjct: 1019 SVRTTTDSGKLITDWCCRSCSL-PPLRFRTENGCWYGMEIRPVRHDETTLVRSQVDAFNG 1077 Query: 306 EI 301 E+ Sbjct: 1078 EM 1079
>POLG_JAEVJ (P32886) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 30.0 bits (66), Expect = 7.0 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = -1 Query: 468 NVHQTVRHGS*FICTCCPSPALRPPQRMSTTKSCWHWSCLKEL------LTRVDVDAASG 307 +V T G CC S +L PP R T CW+ ++ + L R VDA +G Sbjct: 1091 SVRTTTDSGKLITDWCCRSCSL-PPLRFRTENGCWYGMEIRPVRHDETTLVRSQVDAFNG 1149 Query: 306 EI 301 E+ Sbjct: 1150 EM 1151
>POLG_JAEV5 (P19110) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 30.0 bits (66), Expect = 7.0 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = -1 Query: 468 NVHQTVRHGS*FICTCCPSPALRPPQRMSTTKSCWHWSCLKEL------LTRVDVDAASG 307 +V T G CC S +L PP R T CW+ ++ + L R VDA +G Sbjct: 1091 SVRTTTDSGKLITDWCCRSCSL-PPLRFRTENGCWYGMEIRPVRHDETTLVRSQVDAFNG 1149 Query: 306 EI 301 E+ Sbjct: 1150 EM 1151
>POLG_JAEV1 (P27395) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 29.6 bits (65), Expect = 9.1 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 6/62 (9%) Frame = -1 Query: 468 NVHQTVRHGS*FICTCCPSPALRPPQRMSTTKSCWHWSCLKEL------LTRVDVDAASG 307 +V T G CC S +L PP R T CW+ ++ + L R VDA G Sbjct: 1091 SVRTTTDSGKLITDWCCRSCSL-PPLRFRTENGCWYGMEIRPVMHDETTLVRSQVDAFKG 1149 Query: 306 EI 301 E+ Sbjct: 1150 EM 1151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,832,584 Number of Sequences: 219361 Number of extensions: 1719913 Number of successful extensions: 4498 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4498 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)