| Clone Name | rbasd20f23 |
|---|---|
| Clone Library Name | barley_pub |
>UVRD_MYCTU (P64320) Probable DNA helicase II homolog (EC 3.6.1.-)| Length = 700 Score = 29.3 bits (64), Expect = 5.6 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +3 Query: 162 AVQFLPCHRSH*QKQKNLRYGWSRVSANTNFFLQDSSIQV 281 AVQ L H + + LRY WSRV A+T + L DS V Sbjct: 91 AVQALTFHAA---AYRQLRYFWSRVIADTGWQLLDSKFAV 127
>UVRD_MYCBO (P64321) Probable DNA helicase II homolog (EC 3.6.1.-)| Length = 700 Score = 29.3 bits (64), Expect = 5.6 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +3 Query: 162 AVQFLPCHRSH*QKQKNLRYGWSRVSANTNFFLQDSSIQV 281 AVQ L H + + LRY WSRV A+T + L DS V Sbjct: 91 AVQALTFHAA---AYRQLRYFWSRVIADTGWQLLDSKFAV 127
>TBC15_MOUSE (Q9CXF4) TBC1 domain family member 15| Length = 671 Score = 29.3 bits (64), Expect = 5.6 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 191 TLTETKESPVW--LVACLSQYKLLPAGFFHTGASRLL 295 ++ ++KE W LV CL +LPA FH G S+LL Sbjct: 137 SVKQSKEGMGWSYLVFCLKDDVMLPALHFHQGDSKLL 173
>GLR13_ARATH (Q9FH75) Glutamate receptor 1.3 precursor (Ligand-gated ion channel| 1.3) Length = 860 Score = 29.3 bits (64), Expect = 5.6 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -2 Query: 346 RHLYGRNNNLEAPVW---KKQQP*GTCMEESCRKKFVLAETRDQPYRR 212 RHL +N LE +W Q P GT + +S RKK + T + R Sbjct: 405 RHLSSTHNKLETIIWPGGSAQSPKGTSLIDSDRKKLRVLVTSSNRFPR 452
>TBC15_HUMAN (Q8TC07) TBC1 domain family member 15| Length = 691 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 191 TLTETKESPVW--LVACLSQYKLLPAGFFHTGASRLL 295 ++ + KE W LV CL +LPA FH G S+LL Sbjct: 137 SIKQNKEGMGWSYLVFCLKDDVVLPALHFHQGDSKLL 173
>Y1119_SYNY3 (P73341) Hypothetical protein sll1119| Length = 361 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 240 ANTNFFLQDSSIQVPQGCCFFHTGAS 317 A TN + I+VP+GC F+H G S Sbjct: 49 ALTNLVFKHYDIEVPKGCRFWHRGLS 74
>APLP1_HUMAN (P51693) Amyloid-like protein 1 precursor (APLP) (APLP-1)| [Contains: C30] Length = 650 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = +1 Query: 262 RILPYRCL--KVVVSSIQVPQGCCFFH 336 +++P+RCL + V ++ VP+GC F H Sbjct: 134 QVVPFRCLPGEFVSEALLVPEGCRFLH 160
>SAHH_BARQU (Q6G1D6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 465 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +1 Query: 184 IDHIDRNKR--ISGMVGRVSQPIQTSSCRILPYRCLKVVVSSIQVPQGCCFFHTGASRLL 357 +DH+ + K I G +G IQ S+ R LP+ +K V + P G RLL Sbjct: 319 LDHMRQVKDMCILGNIGHFDNEIQVSALRNLPWTNIKPQVDIVTFPDGKRIILLSEGRLL 378 Query: 358 S 360 + Sbjct: 379 N 379
>ISPH_SYNY3 (Q55643) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC| 1.17.1.2) Length = 379 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 32 WNS*EEKEIEPHTSIIHPSYAQEK 103 WNS E+ + + HTSIIH Y E+ Sbjct: 137 WNSVEKHKKKEHTSIIHGKYNHEE 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,262,961 Number of Sequences: 219361 Number of extensions: 1455497 Number of successful extensions: 3244 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3229 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)