Clone Name | rbasd20f22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CBPY_CANAL (P30574) Carboxypeptidase Y precursor (EC 3.4.16.5) (... | 29 | 3.4 |
---|
>CBPY_CANAL (P30574) Carboxypeptidase Y precursor (EC 3.4.16.5)| (Carboxypeptidase YSCY) Length = 542 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +1 Query: 70 YTSXTIWHCAPATVYTHCSLQVQQQKDAPPPTVFRLQRSGRRSYCYCRL 216 Y S ++W C PAT+Y + QK R G S CY +L Sbjct: 348 YESGSVWSCVPATIYCNNGQMGPYQKTGRNVYDIRTMCEG-SSLCYSQL 395 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,460,796 Number of Sequences: 219361 Number of extensions: 761936 Number of successful extensions: 1714 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1709 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)