Clone Name | rbasd20f17 |
---|---|
Clone Library Name | barley_pub |
>GLB5_OLIMA (Q7M413) Hemoglobin, extracellular, major globin chain a5| Length = 142 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = -3 Query: 381 DATSMNEL---RKWNEQYGEGGSR 319 D TS+N L R+W E YGEG SR Sbjct: 1 DCTSLNRLLVKRQWAEAYGEGTSR 24
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -2 Query: 250 GHSAPSSGFWYSPRASSSGAMVALYR*ADA*RTPKFPE 137 G S+ S G++ S ASS+ A + +YR D R KF E Sbjct: 537 GGSSGSRGYYSSAFASSTNAYMLIYRLKDPTRNAKFLE 574
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -2 Query: 250 GHSAPSSGFWYSPRASSSGAMVALYR*ADA*RTPKFPE 137 G S+ S G++ S ASS+ A + +YR D R KF E Sbjct: 537 GGSSGSRGYYSSAFASSTNAYMLIYRLKDPARNAKFLE 574
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 408 AKVSPSVAFDATSMNELRKWNEQYGEGGSRSKSPFG 301 A++SPS+ +A LR E +GG ++ P G Sbjct: 1797 ARLSPSIPLEALRDKALRMLGEAVRDGGQHARDPVG 1832
>FGRL1_RAT (Q7TQM3) Fibroblast growth factor receptor-like 1 precursor (FGF| receptor-like protein 1) Length = 529 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 193 HRSKRL*VSTKNQRKEQSGRYKQKGRHRSG 282 HR K+ +S KN + E SG+Y + +R+G Sbjct: 195 HRKKKWTLSLKNLKPEDSGKYTCRVSNRAG 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,327,234 Number of Sequences: 219361 Number of extensions: 848423 Number of successful extensions: 1970 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1970 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)