| Clone Name | rbasd20d17 |
|---|---|
| Clone Library Name | barley_pub |
>EP300_HUMAN (Q09472) E1A-associated protein p300 (EC 2.3.1.48)| Length = 2414 Score = 40.8 bits (94), Expect = 0.003 Identities = 21/51 (41%), Positives = 34/51 (66%) Frame = -2 Query: 582 HARTCKESKCTIPRCRDLKAHLRWTQQQSESRRRAAVNEMMRQRAAEVARS 430 HA+ C+E+KC +P C ++K LR QQQ + R + A +M+R+R A + R+ Sbjct: 1792 HAKHCQENKCPVPFCLNIKQKLR--QQQLQHRLQQA--QMLRRRMASMQRT 1838
>CBP_HUMAN (Q92793) CREB-binding protein (EC 2.3.1.48)| Length = 2442 Score = 38.1 bits (87), Expect = 0.019 Identities = 20/46 (43%), Positives = 31/46 (67%) Frame = -2 Query: 582 HARTCKESKCTIPRCRDLKAHLRWTQQQSESRRRAAVNEMMRQRAA 445 HA+ C+E+KC +P C ++K LR QQQ + R + A ++MR+R A Sbjct: 1829 HAKHCQENKCPVPFCLNIKHKLR--QQQIQHRLQQA--QLMRRRMA 1870
>CBP_MOUSE (P45481) CREB-binding protein (EC 2.3.1.48)| Length = 2441 Score = 34.7 bits (78), Expect = 0.21 Identities = 18/46 (39%), Positives = 31/46 (67%) Frame = -2 Query: 582 HARTCKESKCTIPRCRDLKAHLRWTQQQSESRRRAAVNEMMRQRAA 445 HA+ C+E+KC +P C ++K ++R QQQ + + A ++MR+R A Sbjct: 1830 HAKHCQENKCPVPFCLNIKHNVR--QQQIQHCLQQA--QLMRRRMA 1871
>CBP1_CAEEL (P34545) Protein cbp-1| Length = 2056 Score = 32.0 bits (71), Expect = 1.4 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 582 HARTCKESKCTIPRCRDLKAHLRWTQQQSESRRRAAVNEMMRQR 451 HA+ C CT+P C +++ L +Q+ +RRA + MMR+R Sbjct: 1614 HAKHCTRDACTVPFCMNIRQKL--AEQKRSQQRRA--DMMMRRR 1653
>FBN2_MOUSE (Q61555) Fibrillin-2 precursor| Length = 2907 Score = 30.4 bits (67), Expect = 4.0 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 147 TCAK*AILGVERFFCCCCLGSE--NTCKEQTDQNRTEH 40 +C A +GV R CCC LG N C+ N TEH Sbjct: 1585 SCNTEAGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEH 1622
>ESAM_RAT (Q6AYD4) Endothelial cell-selective adhesion molecule precursor| Length = 394 Score = 29.6 bits (65), Expect = 6.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 126 VWPILHMYKEPSKILSYMSRLLQNKTDTTIQYKLPTARPSI 248 +W + KEP ++LSY L NK T+ + + T S+ Sbjct: 74 IWFLEQEGKEPKQVLSYFKGSLSNKPGVTLVHSISTRNVSL 114
>ATR_CAEEL (Q22258) Serine/threonine-protein kinase ATR (EC 2.7.11.1) (Ataxia| telangiectasia and Rad3-related protein homolog) (ATR homolog) (ATM-like protein 1) (Ce-atl-1) Length = 2531 Score = 29.6 bits (65), Expect = 6.8 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 2/85 (2%) Frame = +3 Query: 33 INHVLFCSDLFVPYRCSLNRDNNNKKTFRRQVWPILHMYKEPSKILSYMSRLLQNKTDTT 212 ++ LF +LF + + + N TF + + I H ++ K+L L Q Sbjct: 236 LDQALFIDELFATFNSLTAKKSTNHMTFPKLLNEIQHFLQDHGKVLIMHKELRQKPVQWL 295 Query: 213 IQY--KLPTARPSIGMLRQLSAWVL 281 I Y + A G+L S +L Sbjct: 296 IIYLELIDDANDKFGLLENFSLLLL 320
>ESAM_MOUSE (Q925F2) Endothelial cell-selective adhesion molecule precursor| Length = 394 Score = 29.3 bits (64), Expect = 8.9 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +3 Query: 126 VWPILHMYKEPSKILSYMSRLLQNKTDTTIQYKLPTARPSI 248 +W + KEP+++LSY++ ++ NK T + + + + S+ Sbjct: 74 IWFLEQEGKEPNQVLSYINGVMTNKPGTALVHSISSRNVSL 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,822,957 Number of Sequences: 219361 Number of extensions: 1757494 Number of successful extensions: 4504 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4499 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)