Clone Name | rbasd20c17 |
---|---|
Clone Library Name | barley_pub |
>SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precursor (Acetyl LDL| receptor) (Scavenger receptor class F member 1) Length = 830 Score = 33.1 bits (74), Expect = 0.42 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +1 Query: 226 CQHSAWG-VHHPDHGPCHSGHLCHPGRLLPHLCGPCPCQTFHHLCG-PCP 369 C H G PD G C C PG L P PCP TF CG CP Sbjct: 310 CPHCRHGEACEPDTGHCQR---CDPGWLGPRCEDPCPTGTFGEDCGSTCP 356
>MEGF6_RAT (O88281) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1574 Score = 32.7 bits (73), Expect = 0.54 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 10/61 (16%) Frame = +1 Query: 226 CQHSAWGVHHPDHGPCHSGHLCH---------PGRLLPHLCGPCPCQTFHHLCGP-CPCQ 375 C +GVH +H C G CH PG PH CP F C C C Sbjct: 1123 CVSGTFGVHCEEHCACRKGASCHHVTGACFCPPGWRGPHCEQACPRGWFGEACAQRCLCP 1182 Query: 376 T 378 T Sbjct: 1183 T 1183
>RPC2_DROME (P25167) DNA-directed RNA polymerase III 128 kDa polypeptide (EC| 2.7.7.6) (RNA polymerase III subunit 2) Length = 1137 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 143 HPPLVKRETSEMSNISFLPGDSTSSVFMLSY 51 H P+VK +T E++N LP ++V ++SY Sbjct: 723 HAPMVKSKTIELTNFDKLPAGQNATVAVMSY 753
>MEGF6_MOUSE (Q80V70) Multiple epidermal growth factor-like domains 6 (EGF-like| domain-containing protein 3) (Multiple EGF-like domain protein 3) (Fragment) Length = 656 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 226 CQHSAWGVHHPDHGPCHSGHLCHPGRLLPHLCGPCPC 336 C +GVH +H C G CH H+ G C C Sbjct: 205 CVSGMFGVHCEEHCACRKGATCH------HVTGACLC 235
>LAMA5_MOUSE (Q61001) Laminin alpha-5 chain precursor| Length = 3718 Score = 30.0 bits (66), Expect = 3.5 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 8/58 (13%) Frame = +1 Query: 226 CQHSAWGVHHPDHGPCHSGHLCHPGRLL--PHLCGPCPCQ------TFHHLCGPCPCQ 375 CQH G++ C G P + L PH+C PC C+ T L G C C+ Sbjct: 401 CQHHTTGINCER---CLPGFFRAPDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCR 455
>MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment)| Length = 1513 Score = 29.6 bits (65), Expect = 4.6 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 271 CHS---GHLCHPGRLLPHLCGPCPCQTFHHLCGPCPC 372 CH GHL PG+ + + C C C +C PC Sbjct: 348 CHCKLHGHLYMPGQEITNDCEQCVCNAGRWMCKDLPC 384
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 29.3 bits (64), Expect = 6.0 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 271 CHS---GHLCHPGRLLPHLCGPCPCQTFHHLCGPCPC 372 CH GHL PG+ + + C C C +C PC Sbjct: 351 CHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPC 387
>STC_DROME (P40798) Protein shuttle craft| Length = 1106 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 250 HHPDHGPCHSGHLCHPGRLLPHLCGPCPC 336 HH CH+G C P +L P CPC Sbjct: 587 HHKCKDSCHAGS-CRPCKLSPEQITSCPC 614 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,240,643 Number of Sequences: 219361 Number of extensions: 1109243 Number of successful extensions: 3234 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3216 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)