| Clone Name | rbasd20b09 |
|---|---|
| Clone Library Name | barley_pub |
>THF1_ORYSA (Q84PB7) Protein THYLAKOID FORMATION1, chloroplast precursor| Length = 287 Score = 31.6 bits (70), Expect = 0.51 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 283 TPKPNEAVAKFDGSTYPLKH 224 TPK NEAV KFDGS ++H Sbjct: 268 TPKSNEAVTKFDGSLNSMRH 287
>COPB_RAT (P23514) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 184 QILTVIH-LDSVENYRGHLWLLLAWCSTR 101 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_MOUSE (Q9JIF7) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 184 QILTVIH-LDSVENYRGHLWLLLAWCSTR 101 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>COPB_HUMAN (P53618) Coatomer subunit beta (Beta-coat protein) (Beta-COP)| Length = 953 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -3 Query: 184 QILTVIH-LDSVENYRGHLWLLLAWCSTR 101 ++L V H + SV+ YRG LW+L +CST+ Sbjct: 441 KMLEVFHAIKSVKIYRGALWILGEYCSTK 469
>VNUC_MABVM (P27588) Nucleoprotein (Nucleocapsid protein)| Length = 692 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 220 LNLSPEESLSG*QILTVIHLDSVENYRGHLWLLLAWCS 107 L++SP E IL + L+S E+ RG + L L++CS Sbjct: 100 LDVSPNEPHYSPLILALKTLESTESQRGRIGLFLSFCS 137
>ATM_SCHPO (O74630) Serine/threonine-protein kinase tel1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel1) (Telomere length regulation protein 1) (ATM homolog) Length = 2812 Score = 28.5 bits (62), Expect = 4.3 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = -2 Query: 320 REGKEEESREIGDAQAERGCCKIRWK---HLSLEALTQPFPRGELVRITDINSY 168 R+ K + + G+++AER K+R K LS+EA GEL+RI SY Sbjct: 2752 RDPKIQRNNVSGESEAERAILKVRQKLSSTLSVEASV-----GELIRIAQDPSY 2800
>SRE37_CAEEL (O17818) Serpentine receptor class epsilon-37 (Protein sre-37)| Length = 362 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 54 ITKYQLLRIIWIFLYRRVLHHAKSSQRC 137 +T Y L+RI WIFL +V H + C Sbjct: 43 LTGYILVRICWIFLTIKVFHDNMNIMMC 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,030,173 Number of Sequences: 219361 Number of extensions: 792444 Number of successful extensions: 2039 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2039 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)