Clone Name | rbasd19p19 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contain... | 30 | 2.2 | 2 | PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contain... | 30 | 2.9 | 3 | TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnorm... | 30 | 2.9 |
---|
>PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.4 bits (67), Expect = 2.2 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -1 Query: 193 GEVVTRFP*VNLRKDHCRDPDQN-RP-CSRHPILRRW 89 G + ++FP NL+K++CR+PD+ RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRW 254
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.0 bits (66), Expect = 2.9 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -1 Query: 193 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 89 G + ++FP NL+K++CR+PD + RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRW 254
>TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnormal gonad| development protein 2) Length = 2032 Score = 30.0 bits (66), Expect = 2.9 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +3 Query: 243 RTAPVAAIRTLHRTIQSVGATGGVYKGQGRSQRELMTRA 359 RTAP+ R HR +S TGGVY +G R L+ A Sbjct: 124 RTAPIKKTRK-HRRRRSGSFTGGVYPRKGHRNRSLLGHA 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,307,264 Number of Sequences: 219361 Number of extensions: 1205021 Number of successful extensions: 2721 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2720 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)