Clone Name | rbasd19o03 |
---|---|
Clone Library Name | barley_pub |
>ATPJ_YEAST (P81449) ATP synthase e chain, mitochondrial (EC 3.6.3.14)| (Translocase of the inner membrane protein 11) Length = 95 Score = 31.6 bits (70), Expect = 2.4 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 171 NYTRREKQVSYQHPYPLVIQLNKLSSSLSCFLPDEDAPPHGSLNLKPPN 317 N ++E+Q Y+ LV + K + L + +D P + S NL+ PN Sbjct: 28 NAKKKEEQAQYEEKLKLVEEAKKEYAKLHPVVTPKDVPANASFNLEDPN 76
>DMRT1_CHICK (Q9PTQ7) Doublesex- and mab-3-related transcription factor 1| (Fragment) Length = 311 Score = 30.0 bits (66), Expect = 7.0 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +3 Query: 183 REKQVSYQHPYPLVIQ----LNKLSSSLSCFLPDEDAPPHGS 296 +E+++ HP PL + K SSS SC L D +P H + Sbjct: 64 QEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHST 105
>CWC22_ASPFU (Q4WKB9) Pre-mRNA-splicing factor cwc22| Length = 881 Score = 29.6 bits (65), Expect = 9.1 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = +2 Query: 200 LPTSVSPSHPAQQAELFSQLLSS*RRCPTAWQP*S*ATQQQPYRMREHDHPRS*SPVQEK 379 LP P+ PA+ AE S+ +SS C T T R R + + R SP + + Sbjct: 623 LPKPTVPALPARDAESDSESVSSHSTCST-------CTGSSRSRSRSYSYSR--SPSRSR 673 Query: 380 GRRES 394 GRR S Sbjct: 674 GRRRS 678
>DNAA_CHLTE (Q8KGG6) Chromosomal replication initiator protein dnaA| Length = 493 Score = 29.6 bits (65), Expect = 9.1 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +3 Query: 444 HMLHLFFILQHVMASPSYLLHQTVINTTRGSPATVQASHQKD 569 + +H+ L+ V+ + L++ VI+ ++G P T++ HQ D Sbjct: 78 YSVHVKQALRQVIGPEAKLMYSIVIDKSQGQPVTIELPHQID 119
>LCE4A_HUMAN (Q5TA78) Late cornified envelope protein 4A (Late envelope protein| 8) (Small proline-rich-like epidermal differentiation complex protein 4A) Length = 99 Score = 29.6 bits (65), Expect = 9.1 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +2 Query: 512 SHQHHPRFSCNRPGQSSKGLGAGDCMDRPNAENSKLCGCCGGRSKC 649 SH H R C+RP S +C + + S GCC G C Sbjct: 61 SHHRHHRSHCHRPKSS-------NCYGSGSGQQSGGSGCCSGGGCC 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,795,063 Number of Sequences: 219361 Number of extensions: 2090633 Number of successful extensions: 4989 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4981 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)