Clone Name | rbasd19o01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1474_METJA (Q58869) UPF0129 protein MJ1474 | 30 | 2.4 | 2 | GRAP2_MOUSE (O89100) GRB2-related adaptor protein 2 (GADS protei... | 30 | 4.1 | 3 | GRAP2_HUMAN (O75791) GRB2-related adapter protein 2 (GADS protei... | 30 | 4.1 | 4 | ARA_DROME (Q24248) Homeobox protein araucan | 29 | 5.3 | 5 | SYH_BUCAI (P57375) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histi... | 28 | 9.1 |
---|
>Y1474_METJA (Q58869) UPF0129 protein MJ1474| Length = 197 Score = 30.4 bits (67), Expect = 2.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 326 PPKRVDFWMINRLTFDLFSFFRSGI 400 PP+ W+IN+ + LF+ +RSGI Sbjct: 6 PPEFYKLWIINKSPYQLFNIYRSGI 30
>GRAP2_MOUSE (O89100) GRB2-related adaptor protein 2 (GADS protein) (Growth| factor receptor-binding protein) (GRBLG) (GRB-2-like protein) (GRB2L) (Hematopoietic cell-associated adaptor protein GrpL) (GRB-2-related monocytic adapter protein) (Monocytic ada Length = 322 Score = 29.6 bits (65), Expect = 4.1 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +2 Query: 242 ISFHSEDEVPS---AR*SRGEYSIWTRDLPKPPKRVDFWMINRLTFDLFSFFRSG 397 IS ED+V R ++G Y +WT P K VD++ ++ F R G Sbjct: 94 ISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDG 148
>GRAP2_HUMAN (O75791) GRB2-related adapter protein 2 (GADS protein) (Growth| factor receptor-binding protein) (GRBLG) (Grf40 adapter protein) (Grf-40) (GRB-2-like protein) (GRB2L) (GRBX) (P38) (Hematopoietic cell-associated adapter protein GrpL) (Adapter p Length = 330 Score = 29.6 bits (65), Expect = 4.1 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +2 Query: 242 ISFHSEDEVPS---AR*SRGEYSIWTRDLPKPPKRVDFWMINRLTFDLFSFFR 391 IS ED+V R ++G Y +WT P K VD++ N ++ F R Sbjct: 94 ISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLR 146
>ARA_DROME (Q24248) Homeobox protein araucan| Length = 717 Score = 29.3 bits (64), Expect = 5.3 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 297 YSPRDYRAEGTSSSEWKEISVKQYTEILFQPLHSK 193 YSPRD + G SSS Q E +F+PL K Sbjct: 680 YSPRDDYSSGNSSSSSSSSPQLQRNEAMFKPLFKK 714
>SYH_BUCAI (P57375) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 423 Score = 28.5 bits (62), Expect = 9.1 Identities = 22/75 (29%), Positives = 35/75 (46%) Frame = +1 Query: 130 FYLLGAQCHGSDAGQLELPDFLGVQRLEKNLGVLLHGDLFPF*R*SALSSVISRRIQYLD 309 FY LGA+ G D ++L + RL K +G+ D F +++ S I R+QY Sbjct: 124 FYQLGAEVFGLDTEDIDLEIIILTNRLWKRIGI----DSFITLEVNSIGSKID-RVQYKK 178 Query: 310 SRPSKTSKKS*FLDD 354 + K+ LD+ Sbjct: 179 ELVNFLKKREYLLDE 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,608,817 Number of Sequences: 219361 Number of extensions: 1269992 Number of successful extensions: 3333 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3333 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)