Clone Name | rbasd19m06 |
---|---|
Clone Library Name | barley_pub |
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 46.6 bits (109), Expect = 5e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = -3 Query: 403 KCCNNCR-SFSGVDVCDDAHPQCPKGCSACRV---VTPSPHKTFRCADMKSTVDGTCGGP 236 KCC NC SFSG+ CDD C C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 235 C 233 C Sbjct: 102 C 102
>DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3)| Length = 347 Score = 30.8 bits (68), Expect = 2.8 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 190 VPPRIKLR*DEQSSCCYVCVWAVLHGQQYVRCLSSLC 80 +PPR++ +EQ S C +C+ + + + +C S C Sbjct: 149 LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFC 185
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 30.4 bits (67), Expect = 3.6 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 246 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHWGWASSQTST 371 Q+P T +FMSA N L TT E P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 30.0 bits (66), Expect = 4.7 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -3 Query: 400 CCNNCRSFSGVD-----VCDDAHPQCPKGCSACRVVTPSPHKTFRCAD 272 CCN C VC D CP C++C V T S RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSC-VCTRSNPPQCRCTD 57
>ARHG6_HUMAN (Q15052) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) (PAK-interacting exchange factor alpha) (Alpha-Pix) (COOL-2) Length = 776 Score = 29.6 bits (65), Expect = 6.1 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +3 Query: 114 PCSTAHTQT*QHDDCSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 266 P S + CS+H SF G PR L KP S C PP PS L Sbjct: 550 PASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606
>ARHG6_RAT (Q5XXR3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 772 Score = 29.6 bits (65), Expect = 6.1 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +3 Query: 114 PCSTAHTQT*QHDDCSSHLSFILGGTPRPSL------KP*SDQCFLHGPPQVPSTVL 266 P S + CS+H SF G PR L KP S C PP PS L Sbjct: 550 PASCSSLSKTSSSSCSTHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606
>ARHG6_MOUSE (Q8K4I3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 771 Score = 29.6 bits (65), Expect = 6.1 Identities = 26/93 (27%), Positives = 30/93 (32%), Gaps = 16/93 (17%) Frame = +3 Query: 36 CLFNKXTPAFSRERKHSDDKQRTYCW----------PCSTAHTQT*QHDDCSSHLSFILG 185 C+F R H ++ Q W P S CS+H SF Sbjct: 513 CMFEITGSTVERIVVHCNNNQDFQEWMEQLNRLTKGPTSCGSLSKTSSSSCSTHSSFSST 572 Query: 186 GTPRPSL------KP*SDQCFLHGPPQVPSTVL 266 G PR L KP S C PP PS L Sbjct: 573 GQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 605
>CATC_PLAF7 (Q8IIJ9) Probable cathepsin C precursor (EC 3.4.22.-)| Length = 700 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 135 VCGPCYTANNMYAVYRHCVFSLEKKL 58 +CG CY A+ +YA R +L KKL Sbjct: 394 LCGSCYIASQLYAFKRRIEVALTKKL 419 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,181,413 Number of Sequences: 219361 Number of extensions: 1136510 Number of successful extensions: 3016 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3011 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)