Clone Name | rbasd19l06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IMB1_RAT (P52296) Importin beta-1 subunit (Karyopherin beta-1 su... | 35 | 0.17 | 2 | IMB1_MOUSE (P70168) Importin beta-1 subunit (Karyopherin beta-1 ... | 35 | 0.17 | 3 | IMB1_HUMAN (Q14974) Importin beta-1 subunit (Karyopherin beta-1 ... | 35 | 0.17 | 4 | SALM_DROVI (P39806) Homeotic protein spalt-major | 30 | 7.1 | 5 | A1AT_RAT (P17475) Alpha-1-antiproteinase precursor (Alpha-1-anti... | 30 | 9.3 |
---|
>IMB1_RAT (P52296) Importin beta-1 subunit (Karyopherin beta-1 subunit)| (Nuclear factor P97) Length = 875 Score = 35.4 bits (80), Expect = 0.17 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -3 Query: 547 LCEMLVQSTGSDLYLLPALPRNKWPHGSVKGLRARGGVTVNICWKEGSLHEA 392 +CE+L ++ +D+YL P L ++GL A V N+CW SL EA Sbjct: 434 ICELLPEAAINDVYLAPLL------QCLIEGLSAEPRVASNVCWAFSSLAEA 479
>IMB1_MOUSE (P70168) Importin beta-1 subunit (Karyopherin beta-1 subunit)| (Nuclear factor P97) (Pore targeting complex 97 kDa subunit) (PTAC97) (SCG) Length = 876 Score = 35.4 bits (80), Expect = 0.17 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -3 Query: 547 LCEMLVQSTGSDLYLLPALPRNKWPHGSVKGLRARGGVTVNICWKEGSLHEA 392 +CE+L ++ +D+YL P L ++GL A V N+CW SL EA Sbjct: 435 ICELLPEAAINDVYLAPLL------QCLIEGLSAEPRVASNVCWAFSSLAEA 480
>IMB1_HUMAN (Q14974) Importin beta-1 subunit (Karyopherin beta-1 subunit)| (Nuclear factor P97) (Importin 90) Length = 876 Score = 35.4 bits (80), Expect = 0.17 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = -3 Query: 547 LCEMLVQSTGSDLYLLPALPRNKWPHGSVKGLRARGGVTVNICWKEGSLHEA 392 +CE+L ++ +D+YL P L ++GL A V N+CW SL EA Sbjct: 435 ICELLPEAAINDVYLAPLL------QCLIEGLSAEPRVASNVCWAFSSLAEA 480
>SALM_DROVI (P39806) Homeotic protein spalt-major| Length = 1402 Score = 30.0 bits (66), Expect = 7.1 Identities = 26/77 (33%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Frame = -3 Query: 604 LFTAHPPFQIDANFG-FPAA----LCEMLVQSTGSDLYLLPALPRNKWPHGSVKGLRARG 440 L +A PPF + N FP A +C + Q S ++PA P N V RG Sbjct: 1283 LISARPPFGMFPNLPIFPPATTQNMCNAMNQIAQS---VMPAAPFNPLALSGV-----RG 1334 Query: 439 GVTVNICWKEGSLHEAL 389 T IC+K H AL Sbjct: 1335 STTCGICYKTFPCHSAL 1351
>A1AT_RAT (P17475) Alpha-1-antiproteinase precursor (Alpha-1-antitrypsin)| (Alpha-1-proteinase inhibitor) Length = 411 Score = 29.6 bits (65), Expect = 9.3 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 405 ACMKRLYGLAAAGIRLRGSTMATALP*SVPPQVKF 301 A K + L G G+T+ A+P S+PPQVKF Sbjct: 350 AVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKF 384 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,099,856 Number of Sequences: 219361 Number of extensions: 2177428 Number of successful extensions: 5291 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5291 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)