| Clone Name | rbasd19k01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | H6ST2_BRARE (Q800H9) Heparan-sulfate 6-O-sulfotransferase 2 (EC ... | 28 | 1.6 | 2 | KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-ass... | 31 | 3.3 | 3 | ZG66_XENLA (P18733) Gastrula zinc finger protein XLCGF66.1 (Frag... | 30 | 5.7 | 4 | KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-ass... | 30 | 5.7 |
|---|
>H6ST2_BRARE (Q800H9) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) Length = 468 Score = 28.1 bits (61), Expect(2) = 1.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 393 PSRHGYCSTRLSAEVWRFLSSW 328 PSR+ Y T L VWR+LS W Sbjct: 186 PSRNYYYITILRDPVWRYLSEW 207 Score = 22.3 bits (46), Expect(2) = 1.6 Identities = 11/36 (30%), Positives = 16/36 (44%), Gaps = 9/36 (25%) Frame = -2 Query: 590 RCTCFHPSICAYWMGNSFD---CCGME------TNC 510 +CTC+ P W+ + F CG+ TNC Sbjct: 134 KCTCYRPGKRDTWLFSRFSTGWSCGLHADWTELTNC 169
>KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-associated protein| 4.3) (Ultrahigh sulfur keratin-associated protein 4.3) (Fragment) Length = 98 Score = 30.8 bits (68), Expect = 3.3 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -2 Query: 602 TRCCRCTCFHPSICAYWMGNSFDCC 528 T CCR TCFHP C G+S CC Sbjct: 80 TTCCRTTCFHPICC----GSS--CC 98
>ZG66_XENLA (P18733) Gastrula zinc finger protein XLCGF66.1 (Fragment)| Length = 606 Score = 30.0 bits (66), Expect = 5.7 Identities = 20/72 (27%), Positives = 28/72 (38%) Frame = +2 Query: 326 SQDERNLQTSAESLVEQ*PCLEGGDEGKPRADSYGHKNDHSHASIIQASQRAHCFPQTQS 505 S DE + S +L + C EG ++D H+N H S+ CF S Sbjct: 230 SPDESGITKS--TLHSKDSCNEGHKHLSHKSDYNKHQNPHKRQKSFSCSKCGKCFSNLTS 287 Query: 506 LHNWFPCHSNRK 541 LH H +K Sbjct: 288 LHCHQKTHKGKK 299
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 30.0 bits (66), Expect = 5.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 605 KTRCCRCTCFHPSIC 561 +T CCR TC HPS C Sbjct: 52 QTTCCRTTCCHPSCC 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,052,253 Number of Sequences: 219361 Number of extensions: 1977021 Number of successful extensions: 4710 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4706 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)