Clone Name | rbasd19h14 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.1... | 31 | 3.0 |
---|
>DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.107)| (Diglyceride kinase 3) (DGK-3) (DAG kinase 3) Length = 812 Score = 30.8 bits (68), Expect = 3.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 153 GLLGFRFCRWCNKGPPKVPPACHVHHRPESCLRGRCDLG 269 G+ + CRWC+ +VHHR S L CDLG Sbjct: 349 GVFQGKGCRWCHN---------YVHHRCMSALAQECDLG 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,656,600 Number of Sequences: 219361 Number of extensions: 1386316 Number of successful extensions: 3309 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3307 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)