ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd19h02 |
|---|---|
| Clone Library Name | barley_pub |
>CLPP1_ANASP (Q8YXH5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 204 Score = 44.3 bits (103), Expect = 3e-04 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLG 499 E+I EDT D FMSP EAKDYG+ID +ID G Sbjct: 162 ERIAEDTERDFFMSPDEAKDYGLIDQVIDRHAAG 195
>CLPP3_PROMM (Q7V7R2) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 197 Score = 40.0 bits (92), Expect = 0.005 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I EDT D FMSP EA YG++DS+ID+ Sbjct: 161 ERIQEDTDRDFFMSPAEAVGYGLVDSVIDK 190
>CLPP_AQUAE (O67357) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 39.7 bits (91), Expect = 0.007 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +++I D D FMSP+EAKDYG+ID +I++ Sbjct: 169 KDKIANDIERDYFMSPYEAKDYGLIDKVIEK 199
>CLPP2_SYNPX (Q7U6N7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 197 Score = 39.7 bits (91), Expect = 0.007 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 ++I +DT D FMSP EA +YG+IDS+ID+ Sbjct: 161 DRIQQDTDRDFFMSPGEAVEYGLIDSVIDK 190
>CLPP_LACPL (Q88YH9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 39.7 bits (91), Expect = 0.007 Identities = 16/33 (48%), Positives = 25/33 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E+++ DT D+++S EAKDYG+ID I++ KL Sbjct: 163 EKLNHDTERDNYLSAQEAKDYGLIDDIMENNKL 195
>CLPP3_PROMP (Q7UZK7) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 215 Score = 38.5 bits (88), Expect = 0.015 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I+EDT D F+SP EA +YG+ID +I K Sbjct: 184 EKINEDTERDYFLSPEEAVEYGLIDKVIKNDK 215
>CLPP2_SYNY3 (Q59993) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 226 Score = 37.7 bits (86), Expect = 0.026 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E++ EDT D FMS EAK+YG+ID +I L Sbjct: 183 EKLQEDTERDFFMSAEEAKEYGLIDQVISRPNL 215
>CLPP_CARHZ (Q3AF96) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 37.7 bits (86), Expect = 0.026 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSII 517 +E+I+ DT D FMS EAK+YGIID +I Sbjct: 163 KEKIERDTERDFFMSAAEAKEYGIIDEVI 191
>CLPP_GEOSL (Q74C82) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 37.4 bits (85), Expect = 0.034 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIID 514 +++ DT D FMS EAKDYGIID+II+ Sbjct: 163 KVEADTERDYFMSGAEAKDYGIIDNIIE 190
>CLPP3_SYNY3 (P74467) Probable ATP-dependent Clp protease proteolytic subunit 3| (EC 3.4.21.92) (Endopeptidase Clp 3) Length = 202 Score = 37.0 bits (84), Expect = 0.044 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLG 499 E+I +DT D F+S EAK+YG+ID +I+ +G Sbjct: 167 EKIAKDTDRDYFLSAAEAKEYGLIDKVIENSTMG 200
>CLPP_PSEPF (Q3K9W9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 211 Score = 37.0 bits (84), Expect = 0.044 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I+ DT D+FMS AK+YG+ID +I++ Sbjct: 179 EEIERDTNRDNFMSAEAAKEYGLIDEVINQ 208
>CLPP3_PROMA (Q7V9L6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 216 Score = 37.0 bits (84), Expect = 0.044 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E+I EDT D F+SP EA +YG+ID +++ Sbjct: 185 EKISEDTDRDHFLSPQEAVEYGLIDKVVN 213
>CLPP2_PROMA (Q7VAR9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 36.6 bits (83), Expect = 0.057 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D F+S EAKDYG+ID +I Sbjct: 167 EKIEKDTDRDYFLSAKEAKDYGLIDKVI 194
>CLPP_COXBU (Q83DJ2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 36.6 bits (83), Expect = 0.057 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E++++DT D F++P EA +YG+IDSI E Sbjct: 164 ERVEKDTNRDYFLTPEEAVEYGLIDSIFKE 193
>CLPP_STAS1 (Q49VZ2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 36.6 bits (83), Expect = 0.057 Identities = 14/28 (50%), Positives = 23/28 (82%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D+F+S EAKDYG++D ++ Sbjct: 163 EKIEQDTDRDNFLSAEEAKDYGLVDQVM 190
>CLPP_THEMA (Q9WZF9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 36.2 bits (82), Expect = 0.075 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D FMS EAK+YGI+D ++ Sbjct: 172 EKIEKDTDRDFFMSAEEAKEYGIVDKVV 199
>CLPP_GEOMG (Q39UH2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 36.2 bits (82), Expect = 0.075 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+++ DT D FMS EAK YGIID+II Sbjct: 162 EKVEADTERDYFMSGEEAKSYGIIDAII 189
>CLPP3_SYNP7 (Q9L4P3) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 199 Score = 36.2 bits (82), Expect = 0.075 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I++DT D FMS EA++YG+ID +I E Sbjct: 167 EKIEKDTDRDYFMSAEEAREYGLIDQVIAE 196
>CLPP2_SYNP6 (Q5N1Q7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 199 Score = 36.2 bits (82), Expect = 0.075 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I++DT D FMS EA++YG+ID +I E Sbjct: 167 EKIEKDTDRDYFMSAEEAREYGLIDQVIAE 196
>CLPP2_PROMM (Q7V8M4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 36.2 bits (82), Expect = 0.075 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D F+S EAKDYG+ID +I Sbjct: 167 EKIEKDTDRDYFLSAAEAKDYGLIDRVI 194
>CLPP2_ANASP (Q8YQX8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 232 Score = 35.8 bits (81), Expect = 0.098 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E+I+ DT D FMS EAK+YG+ID +I L Sbjct: 189 ERIEADTDRDFFMSAEEAKNYGLIDQVISRQNL 221
>CLPP_PSEF5 (Q4K9J6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 211 Score = 35.8 bits (81), Expect = 0.098 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I+ DT D+FMS A++YG+ID +I++ Sbjct: 179 EEIERDTNRDNFMSAEAAREYGLIDEVINQ 208
>CLPP1_PROMT (Q46L44) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 196 Score = 35.8 bits (81), Expect = 0.098 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGLV 493 E+I EDT D +MSP EA +YGIID++ ++ + V Sbjct: 161 ERIREDTDRDFYMSPSEAIEYGIIDNVFNKRPINSV 196
>CLPP3_SYNP6 (Q5N1P6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 240 Score = 35.8 bits (81), Expect = 0.098 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+ DT D FMSP EAK YG+ID ++ Sbjct: 197 EKIEVDTDRDFFMSPEEAKAYGLIDQVL 224
>CLPP2_SYNP7 (O34125) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 240 Score = 35.8 bits (81), Expect = 0.098 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+ DT D FMSP EAK YG+ID ++ Sbjct: 197 EKIEVDTDRDFFMSPEEAKAYGLIDQVL 224
>CLPP_PSEU2 (Q4ZVM7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 213 Score = 35.4 bits (80), Expect = 0.13 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E I+ DT D+FMS A +YG+IDS+I++ ++ Sbjct: 179 ETIERDTERDNFMSAERAAEYGLIDSVINKRQM 211
>CLPP_PSESM (Q87YR6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 213 Score = 35.4 bits (80), Expect = 0.13 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E I+ DT D+FMS A +YG+IDS+I++ ++ Sbjct: 179 ETIERDTERDNFMSAERAAEYGLIDSVINKRQM 211
>CLPP_PSE14 (Q48KZ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 213 Score = 35.4 bits (80), Expect = 0.13 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E I+ DT D+FMS A +YG+IDS+I++ ++ Sbjct: 179 ETIERDTERDNFMSAERAAEYGLIDSVINKRQM 211
>CLPP_LISMO (Q9RQI6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 35.4 bits (80), Expect = 0.13 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I DT D+FM+ EAKDYG+ID II Sbjct: 163 EVIARDTDRDNFMTAQEAKDYGLIDDII 190
>CLPP_LISMF (Q71WV9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 35.4 bits (80), Expect = 0.13 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I DT D+FM+ EAKDYG+ID II Sbjct: 163 EVIARDTDRDNFMTAQEAKDYGLIDDII 190
>CLPP_LISIN (Q928C4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 35.4 bits (80), Expect = 0.13 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I DT D+FM+ EAKDYG+ID II Sbjct: 163 EVIARDTDRDNFMTAQEAKDYGLIDDII 190
>CLPP2_SYNEL (Q8DJZ9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 198 Score = 35.4 bits (80), Expect = 0.13 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I+ D D FMS EAK+YG+ID +I+E Sbjct: 166 EKIERDMDRDFFMSAEEAKNYGLIDRVIEE 195
>CLPP3_PROMT (Q46ID4) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 194 Score = 35.4 bits (80), Expect = 0.13 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++I EDT D F+SP EA +YG+ID ++ Sbjct: 161 QKISEDTDRDHFLSPQEAVEYGLIDKVV 188
>CLPP1_MYXXA (O30612) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 203 Score = 35.4 bits (80), Expect = 0.13 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGLVAP 487 E+I++DT D FMS +A+ YG+ID +++ K ++AP Sbjct: 162 ERIEKDTERDYFMSAEDARQYGLIDEVVE--KQRVIAP 197
>CLPP1_SYNPX (Q7UA36) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 224 Score = 35.4 bits (80), Expect = 0.13 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID-EGKLGLV 493 ++I EDT D F+SP EA YG+ID ++D G G+V Sbjct: 185 DKIAEDTDRDYFLSPAEAVQYGLIDRVVDSSGGEGIV 221
>CLPP_PSEPK (Q88KJ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 213 Score = 35.0 bits (79), Expect = 0.17 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E I DT D+FMS A +YG+IDS+ D+ +L Sbjct: 179 ETIKRDTERDNFMSASRAAEYGLIDSVYDKRQL 211
>CLPP_MANSM (Q65RF6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FMS +AK+YG+IDS++ Sbjct: 163 EVIERDTDRDNFMSAEDAKNYGLIDSVL 190
>CLPP1_BACC1 (Q736T1) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 35.0 bits (79), Expect = 0.17 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I DT D FM+ EAK+YGI+D ++++ Sbjct: 163 EKIAHDTERDYFMTAEEAKEYGIVDGVVEK 192
>CLPP_STAES (Q8CTE0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.0 bits (79), Expect = 0.17 Identities = 14/32 (43%), Positives = 24/32 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I +DT D+F++ EAK+YG+ID +++ K Sbjct: 163 EKIQQDTDRDNFLTAAEAKEYGLIDEVMEPEK 194
>CLPP_STAEQ (Q5HQW0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.0 bits (79), Expect = 0.17 Identities = 14/32 (43%), Positives = 24/32 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I +DT D+F++ EAK+YG+ID +++ K Sbjct: 163 EKIQQDTDRDNFLTAAEAKEYGLIDEVMEPEK 194
>CLPP1_BACHD (Q9K709) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 194 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 EQI +DT D+FM+ +A++YG+ID +I+ K Sbjct: 163 EQIAKDTDRDNFMTAEKAREYGLIDKVIETTK 194
>CLPP_SHISS (Q3Z4W6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SHIFL (P0A6H0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SHIDS (Q32JJ3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SHIBS (Q325G4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SALTY (P0A1D7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SALTI (P0A1D8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SALPA (Q5PFN4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_SALCH (Q57SB5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_ECOLI (P0A6G7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) (Caseinolytic protease) (Protease Ti) (Heat shock protein F21.5) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_ECOL6 (P0A6G8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP_ECO57 (P0A6G9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI+ DT D F+S EA +YG++DSI+ Sbjct: 176 EQIERDTERDRFLSAPEAVEYGLVDSIL 203
>CLPP3_SYNPX (Q7U5Q2) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 200 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++I++DT D F+S EAKDYG+ID +I Sbjct: 167 DKIEKDTDRDYFLSAEEAKDYGLIDRVI 194
>CLPP1_SYNY3 (P54416) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 198 Score = 34.7 bits (78), Expect = 0.22 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E+I DT D FMS E+K+YG+ID +I+ Sbjct: 161 EEITADTERDFFMSAEESKEYGLIDQVIN 189
>CLPP_HELPY (P56156) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 34.7 bits (78), Expect = 0.22 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 EQI +DT D +MS EAK+YG+ID ++ + Sbjct: 164 EQIAKDTDRDFYMSAKEAKEYGLIDKVLQK 193
>CLPP1_SYNP7 (P54415) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 34.7 bits (78), Expect = 0.22 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGLVA 490 +I++DT D FMS EA +YG+ID +ID L A Sbjct: 162 RIEDDTDRDFFMSASEAVEYGLIDRVIDRRALKATA 197
>CLPP1_SYNP6 (Q5N665) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 34.7 bits (78), Expect = 0.22 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGLVA 490 +I++DT D FMS EA +YG+ID +ID L A Sbjct: 162 RIEDDTDRDFFMSASEAVEYGLIDRVIDRRALKATA 197
>CLPP_WOLSU (Q7M7M3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 34.7 bits (78), Expect = 0.22 Identities = 14/30 (46%), Positives = 24/30 (80%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I +DT D FMS E+K+YG+ID+++++ Sbjct: 163 EKIAKDTDRDFFMSAQESKEYGLIDNVLEK 192
>CLPP_HELPJ (Q9ZL50) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 34.7 bits (78), Expect = 0.22 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 EQI +DT D +MS EAK+YG+ID ++ + Sbjct: 163 EQIAKDTDRDFYMSAKEAKEYGLIDKVLQK 192
>CLPP2_PROMP (Q7V0F1) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 201 Score = 34.3 bits (77), Expect = 0.29 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D F+S EAK+YG+ID +I Sbjct: 167 EKIEKDTDRDYFLSAEEAKNYGLIDRVI 194
>CLPP1_SYNEL (Q8DLI2) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 229 Score = 34.3 bits (77), Expect = 0.29 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+ DT D FMS EAK YG+ID ++ Sbjct: 194 ERIEADTERDFFMSAEEAKAYGLIDQVV 221
>CLPP_PASMU (Q9CJM2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 34.3 bits (77), Expect = 0.29 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+ DT D+FMS EAK YG++D ++ Sbjct: 163 ERIERDTDRDNFMSAEEAKAYGLVDEVL 190
>CLPP_CLOAB (P58276) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 34.3 bits (77), Expect = 0.29 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I++DT D F+S EAK+YG+ID +I Sbjct: 163 EVIEKDTDRDHFLSAEEAKEYGLIDEVI 190
>CLPP_NEIMB (Q9JZ38) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 34.3 bits (77), Expect = 0.29 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIID 514 ++ DT D+FMS EAK+YG+ID I++ Sbjct: 171 LERDTDRDNFMSAEEAKEYGLIDQILE 197
>CLPP_DEIRA (Q9RSZ7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 34.3 bits (77), Expect = 0.29 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +E++ D D FMSP EA YG+ID +ID+ Sbjct: 165 QEKLLRDMERDYFMSPEEALKYGLIDQVIDQ 195
>CLPP_CAMJR (Q5HWX6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 34.3 bits (77), Expect = 0.29 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +I +DT D FMS EAK+YG+ID ++++ Sbjct: 163 KIAKDTERDFFMSAQEAKEYGLIDKVLEK 191
>CLPP_CAMJE (P54413) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 34.3 bits (77), Expect = 0.29 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +I +DT D FMS EAK+YG+ID ++++ Sbjct: 163 KIAKDTERDFFMSAQEAKEYGLIDKVLEK 191
>CLPP2_PROMT (Q46JF7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 34.3 bits (77), Expect = 0.29 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D F+S EAK+YG+ID +I Sbjct: 167 EKIEKDTDRDYFLSAEEAKNYGLIDRVI 194
>CLPP_AZOSE (Q5P161) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 212 Score = 33.9 bits (76), Expect = 0.37 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI++DT D FMS +A +YGI+D ++ Sbjct: 179 EQIEKDTDRDRFMSAADAVEYGIVDKVL 206
>CLPP1_BACSK (Q5WLZ7) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 33.9 bits (76), Expect = 0.37 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++I D+ D FMS EAKDYG+ID+I+ Sbjct: 164 DKIATDSERDYFMSAAEAKDYGVIDNIL 191
>CLPP_LEPIN (Q8F352) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 33.9 bits (76), Expect = 0.37 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI +DT + +M+ EAK+YGIID++I Sbjct: 163 EQIQKDTERNFYMTADEAKNYGIIDTVI 190
>CLPP_HELHP (Q7VIN7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 33.9 bits (76), Expect = 0.37 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D FMS EAK YG++D I+ Sbjct: 164 EKITQDTERDFFMSGEEAKKYGLVDEIL 191
>CLPP1_PROMP (Q7V1W0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 196 Score = 33.9 bits (76), Expect = 0.37 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E I DT D +MSP EA +YG+ID ++D+ Sbjct: 161 ETIKGDTDRDFYMSPQEAVEYGLIDLVLDK 190
>CLPP1_LEPIC (Q72SG6) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 198 Score = 33.9 bits (76), Expect = 0.37 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI +DT + +M+ EAK+YGIID++I Sbjct: 163 EQIQKDTERNFYMTADEAKNYGIIDTVI 190
>CLPP_LACSS (Q38Y96) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 33.9 bits (76), Expect = 0.37 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D++M+ EAKDYG+ID I+ Sbjct: 162 EKLQADTDRDNYMTAQEAKDYGLIDDIM 189
>CLPP1_CYAPA (Q36863) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 33.9 bits (76), Expect = 0.37 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 +QI+ DT D F+S EAK YGIID I Sbjct: 163 KQIETDTERDFFLSATEAKQYGIIDHI 189
>CLPP_NEIMA (Q9JU33) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 33.9 bits (76), Expect = 0.37 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIID 514 ++ DT D+FMS EAK+YG+ID +++ Sbjct: 171 LERDTDRDNFMSAEEAKEYGLIDQVLE 197
>CLPP_NEIG1 (Q5F914) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 33.9 bits (76), Expect = 0.37 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIID 514 ++ DT D+FMS EAK+YG+ID +++ Sbjct: 171 LERDTDRDNFMSAEEAKEYGLIDQVLE 197
>CLPP1_PROMM (Q7V992) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 224 Score = 33.9 bits (76), Expect = 0.37 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIID 514 +I EDT D F+SP +A +YG+ID ++D Sbjct: 186 KIAEDTDRDHFLSPAKAVEYGLIDRVVD 213
>CLPP2_BACSK (Q5WDK0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 195 Score = 33.9 bits (76), Expect = 0.37 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E+I DT D+FM+ +AK+YG+ID +I+ Sbjct: 163 ERIARDTDRDNFMTAEQAKEYGLIDKVIE 191
>CLPP_RICFE (Q4ULF0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 33.5 bits (75), Expect = 0.49 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 + I++ D+FMSP EAK +GIID+II Sbjct: 163 KHIEKSMERDNFMSPEEAKKFGIIDNII 190
>CLPP_CHLCH (Q3ATL3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 225 Score = 33.5 bits (75), Expect = 0.49 Identities = 13/30 (43%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E++ ED+ D +M+P EA +YG+ID+I ++ Sbjct: 188 EKVREDSERDRWMNPQEALEYGLIDAIFEK 217
>CLPP1_PROMA (Q7VC22) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 196 Score = 33.5 bits (75), Expect = 0.49 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +I EDT D +MSP EA YGIID+++++ Sbjct: 162 KIAEDTDRDFYMSPSEAISYGIIDNVLNK 190
>CLPP_GLOVI (Q7NEW2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 33.5 bits (75), Expect = 0.49 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+ DT D FMS +AK YG+ID ++ Sbjct: 165 ERIERDTDRDFFMSAEDAKQYGLIDQVV 192
>CLPP_CLOTE (Q891J7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 33.5 bits (75), Expect = 0.49 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E I DT D+FM +AKDYG+ID ++ + K Sbjct: 163 EVIQRDTERDNFMDANQAKDYGLIDEVMVKKK 194
>CLPP_LACJO (Q74K84) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.5 bits (75), Expect = 0.49 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++I +DT D+++S EAKDYG+ID I+ Sbjct: 162 DKILKDTERDNYLSAEEAKDYGLIDEIL 189
>CLPP2_RHOBA (Q7UK66) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 195 Score = 33.5 bits (75), Expect = 0.49 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+EDT D FMS EA YG+ID ++ Sbjct: 163 EKIEEDTDRDRFMSADEACSYGLIDKVV 190
>CLPP2_CORJK (Q4JWV3) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 209 Score = 33.5 bits (75), Expect = 0.49 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 EQ+ DT D ++ EAK+YGI+D + D KL Sbjct: 173 EQVRIDTDRDKILTAEEAKEYGIVDQVFDYRKL 205
>CLPP1_MYCPA (Q73XM9) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 211 Score = 33.1 bits (74), Expect = 0.64 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 I +DT D ++ EAKDYGIID++++ KL Sbjct: 176 IRKDTDRDKILTAEEAKDYGIIDTVLEYRKL 206
>CLPP_HAEIN (P43867) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D+FMS EA+ YG++D ++ Sbjct: 163 ERIEKDTDRDNFMSAEEAQAYGLVDEVL 190
>CLPP_HAEI8 (Q4QMK5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D+FMS EA+ YG++D ++ Sbjct: 163 ERIEKDTDRDNFMSAEEAQAYGLVDEVL 190
>CLPP_STAHJ (Q4L4J5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 23/28 (82%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID+++ Sbjct: 163 EKIQKDTDRDNFLTADEAKEYGLIDNVM 190
>CLPP_STAAW (P63786) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_STAAS (Q6GB62) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_STAAR (Q6GIM3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_STAAN (P99089) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_STAAM (P63785) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_STAAC (Q5HHQ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_STAAB (Q2YSF8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D+F++ EAK+YG+ID ++ Sbjct: 163 EKIQKDTDRDNFLTAEEAKEYGLIDEVM 190
>CLPP_LACAC (Q5FL55) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +DT D++++ EAK+YG+ID I+ Sbjct: 162 EKIQKDTERDNYLTAEEAKEYGLIDEIM 189
>CLPP_DECAR (Q47FB6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 209 Score = 33.1 bits (74), Expect = 0.64 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I++DT D+F+S EA +YG+ID ++ Sbjct: 176 ERIEKDTDRDNFLSAAEAAEYGLIDKVL 203
>CLPP2_PARUW (Q6MBE9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 207 Score = 33.1 bits (74), Expect = 0.64 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I D+ D +MS EAKDYG+ID ++ Sbjct: 173 EKIAADSERDFYMSAVEAKDYGLIDEVV 200
>CLPP2_MYCTU (P63783) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 214 Score = 33.1 bits (74), Expect = 0.64 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 I +DT D ++ EAKDYGIID++++ KL Sbjct: 179 IRKDTDRDKILTAEEAKDYGIIDTVLEYRKL 209
>CLPP2_MYCLE (Q9CBY4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 214 Score = 33.1 bits (74), Expect = 0.64 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 I +DT D ++ EAKDYGIID++++ KL Sbjct: 179 IRKDTDRDKILTAEEAKDYGIIDTVLEYRKL 209
>CLPP2_MYCBO (P63784) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 214 Score = 33.1 bits (74), Expect = 0.64 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 I +DT D ++ EAKDYGIID++++ KL Sbjct: 179 IRKDTDRDKILTAEEAKDYGIIDTVLEYRKL 209
>CLPP2_MYXXA (Q9X5N0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 206 Score = 32.7 bits (73), Expect = 0.83 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 E++++DT D FM EAK YGIID I + K+ Sbjct: 165 ERVEKDTDRDYFMGASEAKAYGIIDEIQNPRKV 197
>CLPP_RICTY (Q68WL5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 + I++ D+FMSP EAK +G++D+II Sbjct: 163 KHIEKSMERDNFMSPGEAKKFGLVDNII 190
>CLPP_MESVI (Q9MUV8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 229 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I +D D+FM P +AK+YG+ID ++ Sbjct: 166 EKIRKDMNRDNFMRPRQAKEYGLIDHMV 193
>CLPP_DESPS (Q6AK59) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++I+ DT D+FMS EA+ YG+ID ++ Sbjct: 163 KKIESDTERDNFMSSVEAQKYGLIDEVL 190
>CLPP_HAEDU (Q7VP78) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++ DT D+FMS EAK+YG+ID ++ Sbjct: 164 KVAADTERDNFMSATEAKNYGLIDKVL 190
>CLPP_CHRVO (Q7NUY9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 210 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D+FMS EA+ YG+ID ++ Sbjct: 175 ERVQSDTERDNFMSAEEARAYGMIDKVL 202
>CLPP_YEREN (Q60107) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I+ DT D F+S EA +YG++DS+ Sbjct: 176 EEIERDTERDRFLSADEAVEYGLVDSV 202
>CLPP_SYNP8 (Q93AD7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 32.7 bits (73), Expect = 0.83 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I +DT D +MS EA+ YG+ID +I++ Sbjct: 167 EKIQKDTDRDYYMSAEEAQAYGLIDKVIED 196
>CLPP_ANAMM (Q5PBD0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 215 Score = 32.7 bits (73), Expect = 0.83 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I+ D+FM +AKD+GI+D +ID+ Sbjct: 180 EEIESSMERDNFMVAEKAKDFGIVDKVIDK 209
>CLPP1_BIFLO (Q8G5R0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 233 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E+I D D+F++ EAK+YGI+D +++ Sbjct: 202 EKIRRDIEVDTFLTAPEAKEYGIVDEVLE 230
>CLPP_DESVH (Q72CE8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQ+ DT D FM P EA+ YG+ID ++ Sbjct: 162 EQVALDTERDYFMGPEEAQAYGLIDRVL 189
>CLPP_RALEJ (Q472D3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 32.3 bits (72), Expect = 1.1 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I DT D+FMS +A DYG+ID +I Sbjct: 185 EKIARDTDRDNFMSGDQAVDYGLIDKVI 212
>CLPP_PELCD (Q3A3X5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 32.3 bits (72), Expect = 1.1 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I DT D FM EAK YGI+D I+ Sbjct: 163 EKIATDTERDFFMGSEEAKKYGIVDDIV 190
>CLPP3_ANASP (Q8YP43) Probable ATP-dependent Clp protease proteolytic subunit 3| (EC 3.4.21.92) (Endopeptidase Clp 3) Length = 197 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +I++D D FMS EA +YG+ID +I+E Sbjct: 167 KIEKDMDRDFFMSAQEAMEYGLIDRVIEE 195
>CLPP1_TREDE (Q73M38) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 32.3 bits (72), Expect = 1.1 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLG 499 E+Q+ D D FMS EA YGIID++++ K G Sbjct: 163 EKQVAADMERDFFMSAEEALTYGIIDTVMNRRKDG 197
>CLPP_LEGPL (Q5WVJ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 +QI DT D+FMS +A +YG+ID ++ Sbjct: 175 DQIMRDTERDNFMSATQAMEYGLIDKVL 202
>CLPP_LEGPH (Q5ZUD9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 +QI DT D+FMS +A +YG+ID ++ Sbjct: 175 DQIMRDTERDNFMSATQAMEYGLIDKVL 202
>CLPP_LEGPA (Q5X451) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 32.3 bits (72), Expect = 1.1 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 +QI DT D+FMS +A +YG+ID ++ Sbjct: 175 DQIMRDTERDNFMSATQAMEYGLIDKVL 202
>CLPP2_CORGL (Q8NN01) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 201 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI +D+ D + + EAKDYG++D +I Sbjct: 165 EQISKDSDRDRWFTAQEAKDYGLVDHVI 192
>CLPP_CHLTE (Q8KC73) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 225 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 597 QIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +I ED+ D +MS EAK+YG+ID I ++ Sbjct: 189 RIREDSERDRWMSAVEAKEYGLIDQIFEK 217
>CLPP_FUSNN (Q8RHJ8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSI 520 +EQI DT D+++S EA +YG+IDS+ Sbjct: 163 KEQILRDTERDNYLSSEEAVNYGLIDSV 190
>CLPP_BURS3 (Q39FE8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I DT D+FMS +AK YG+ID ++ Sbjct: 186 ERIARDTDRDNFMSSEDAKAYGLIDQVL 213
>CLPP1_BACHK (Q6HHU9) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D FM+ EAK YGI+D ++ Sbjct: 163 ERVAHDTERDYFMTAEEAKAYGIVDDVV 190
>CLPP1_BACCZ (Q63AG0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D FM+ EAK YGI+D ++ Sbjct: 163 ERVAHDTERDYFMTAEEAKAYGIVDDVV 190
>CLPP1_BACCR (Q81CH1) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D FM+ EAK YGI+D ++ Sbjct: 163 ERVAHDTERDYFMTAEEAKAYGIVDDVV 190
>CLPP1_BACAN (Q81PL4) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D FM+ EAK YGI+D ++ Sbjct: 163 ERVAHDTERDYFMTAEEAKAYGIVDDVV 190
>CLPP1_TREPA (O83520) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 203 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 EEQ+ ED D F+S +A YGI+D+++ K Sbjct: 167 EEQVREDMERDFFLSAEQACSYGIVDTVMKRRK 199
>CLPP_ENTFA (Q837R0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 32.0 bits (71), Expect = 1.4 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E I+ DT D++M+ +AK+YG+ID +++ Sbjct: 163 EVIERDTDRDNYMTAEQAKEYGLIDEVME 191
>CLPP_VIBPA (Q87R80) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FMS +A +YGI+D+++ Sbjct: 168 EVIERDTDRDNFMSAEQAVEYGIVDAVL 195
>CLPP_PSEHT (Q3IF46) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 205 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSI 520 I +DT D+FMS +A DYGI+DS+ Sbjct: 174 ISKDTDRDNFMSADQAVDYGIVDSV 198
>CLPP_ERWCT (Q6D827) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E I+ DT D F+S EA +YG++DS+ Sbjct: 176 EAIERDTERDRFLSASEAVEYGLVDSV 202
>CLPP_RALSO (Q8XYP7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 31.6 bits (70), Expect = 1.8 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 ++I DT D+FMS +AK+YG+ID ++ Sbjct: 185 DKIARDTDRDNFMSGDQAKEYGLIDKVL 212
>CLPP3_NOCFA (Q5Z062) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 221 Score = 31.6 bits (70), Expect = 1.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 + I +DT D ++ +AK+YGIID++ D KL Sbjct: 185 DTIRKDTDRDKILTAEDAKEYGIIDTVFDYRKL 217
>CLPP1_BACLD (Q65EI5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 198 Score = 31.6 bits (70), Expect = 1.8 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+F + EAK+YG+ID ++ Sbjct: 163 EVIERDTDRDNFKTAEEAKEYGLIDKVL 190
>CLPP_COLP3 (Q47XL8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 220 Score = 31.6 bits (70), Expect = 1.8 Identities = 11/30 (36%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 +++ +DT D+F+S A +YG++DSI+++ Sbjct: 187 DKVSQDTDRDNFLSAEAAVEYGLVDSILEQ 216
>CLPP_DESDG (Q30Z79) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 31.6 bits (70), Expect = 1.8 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I E T D FM P AK++GIID I+ K Sbjct: 162 EKIVEHTDRDYFMGPENAKNFGIIDRILTSRK 193
>CLPP3_STRAW (Q82CA6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 219 Score = 31.6 bits (70), Expect = 1.8 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQ+ D+ D + P EAK+YG+ID I+ Sbjct: 177 EQVTRDSDRDRWFDPVEAKEYGLIDDIM 204
>CLPP_BDEBA (Q6MH11) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 212 Score = 31.2 bits (69), Expect = 2.4 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = -1 Query: 573 DSFMSPWEAKDYGIIDSIIDEGK 505 D+FM P++AK++G++D +++ K Sbjct: 186 DNFMDPYQAKEFGLLDHVVESRK 208
>CLPP1_RHOBA (Q7UK67) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 227 Score = 31.2 bits (69), Expect = 2.4 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI +DT D F+ +AK+YG++D ++ Sbjct: 189 EQIAKDTDRDFFLDAQQAKEYGLVDDLL 216
>CLPP_SHEON (Q8EG19) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 202 Score = 31.2 bits (69), Expect = 2.4 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FMS +A +YG++D+++ Sbjct: 171 EVIERDTDRDNFMSATQAVEYGLVDAVM 198
>CLPP_RICCN (Q92HM5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 31.2 bits (69), Expect = 2.4 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 + I++ D+FMSP EAK +G++D+I+ Sbjct: 163 KHIEKSMERDNFMSPEEAKKFGLVDNIM 190
>CLPP_FRATT (Q5NH47) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E I +DT D+FM EAK YG+ID +I+ Sbjct: 166 ETIVKDTDRDNFMMADEAKAYGLIDHVIE 194
>CLPP_CHAGL (Q8M9Y9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 31.2 bits (69), Expect = 2.4 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSI 520 I ED D FMS EAK+YGI+D + Sbjct: 169 ISEDMERDVFMSAKEAKEYGIVDLV 193
>CLPP_ACIAD (Q6FEP8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 31.2 bits (69), Expect = 2.4 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E++ DT D+FM+ AK+YG++D ++ + Sbjct: 170 ERVARDTDRDNFMTAQAAKEYGLVDEVLSK 199
>CLPP1_CORGL (Q8NN02) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 208 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 EQI DT D ++ EA +YGI+D + D KL Sbjct: 174 EQIRIDTDRDKILTAEEALEYGIVDQVFDYRKL 206
>CLPP_AZOBR (Q9X6W8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 210 Score = 31.2 bits (69), Expect = 2.4 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE--GKLG 499 + I+ D FMSP EAK +G+ID ++++ G +G Sbjct: 171 DTIEAXMERDKFMSPEEAKAFGLIDEVVEKRPGSIG 206
>CLPP2_CHLCV (Q821M0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 31.2 bits (69), Expect = 2.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I ED+ D FM EA YG+ID ++ K Sbjct: 163 EKIIEDSERDFFMGAEEAISYGLIDKVVSSAK 194
>CLPP_PHOPR (Q6LNW0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 31.2 bits (69), Expect = 2.4 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E ++ DT D+FMS +A +YG++DS++ + Sbjct: 168 EVVEGDTDRDNFMSADQAVEYGLVDSVLTQ 197
>CLPP1_GLUOX (Q5FUR3) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 215 Score = 31.2 bits (69), Expect = 2.4 Identities = 11/29 (37%), Positives = 22/29 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 EQI++ DS++S EA+++G+ID +++ Sbjct: 176 EQIEQKLERDSYLSANEAREFGLIDKVVE 204
>NIFH2_PAEAZ (Q9AKT4) Nitrogenase iron protein 2 (EC 1.18.6.1) (Nitrogenase| component II) (Nitrogenase Fe protein 2) (Nitrogenase reductase) Length = 292 Score = 31.2 bits (69), Expect = 2.4 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +2 Query: 62 HKISHEGSYILPRKGGCTARSINQPYTGKIILQYSIQTALQPIFEY 199 HK S EG +L GG A SIN PY +I+ + +T Q + EY Sbjct: 170 HKYSTEGGALL---GGVIANSINAPYAKEIVDDFVARTHTQ-VMEY 211
>CLPP_VIBF1 (Q5E6Q5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 31.2 bits (69), Expect = 2.4 Identities = 12/30 (40%), Positives = 23/30 (76%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E I++DT D+FMS +A YG++D+++++ Sbjct: 176 EVIEQDTDRDNFMSADDAVKYGLVDAVLNK 205
>CLPP1_STRCO (Q9F315) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 219 Score = 31.2 bits (69), Expect = 2.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI D+ D + +EAK+YG+ID +I Sbjct: 178 EQITRDSDRDRWFDAFEAKEYGLIDDVI 205
>CLPP_PORGI (Q7MX09) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 222 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/32 (37%), Positives = 24/32 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 EQ+++D+ D +M+ EA +YG+ID I+++ + Sbjct: 190 EQVEKDSDRDYWMTAPEALEYGMIDKILEKNR 221
>CLPP1_THEFY (Q47MU3) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 222 Score = 30.8 bits (68), Expect = 3.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGL 496 E+I D D ++ EAK+YGI+D ++ K L Sbjct: 187 EEISRDIERDKILTAEEAKEYGIVDDVLPYRKASL 221
>CLPP_BURPS (Q63V41) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I DT D+FMS +AK YG+ID + Sbjct: 186 ERIARDTDRDNFMSSEDAKAYGLIDHV 212
>CLPP_PINKO (Q85X43) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 EE I D D FMS EA+ YGI+D++ + Sbjct: 166 EEVIQRDLDRDVFMSATEARAYGIVDTVAE 195
>CLPP_GEOKA (Q5KVD9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 30.8 bits (68), Expect = 3.2 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FM+ +A +YGIID ++ Sbjct: 163 EVIERDTDRDNFMTAQKAMEYGIIDRVL 190
>CLPP_WHEAT (P24064) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + ED D FMS EAK YG++D + DE Sbjct: 169 VSEDMERDVFMSADEAKAYGLVDIVGDE 196
>CLPP_SACOF (Q6ENT9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + ED D FMS EAK YG++D + DE Sbjct: 169 VSEDMERDVFMSADEAKAYGLVDIVGDE 196
>CLPP_SACHY (Q6L377) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + ED D FMS EAK YG++D + DE Sbjct: 169 VSEDMERDVFMSADEAKAYGLVDIVGDE 196
>CLPP_ORYSA (P12209) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + ED D FMS EAK YG++D + DE Sbjct: 169 VSEDMERDVFMSADEAKAYGLVDIVGDE 196
>CLPP_ORYNI (Q6ENE9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + ED D FMS EAK YG++D + DE Sbjct: 169 VSEDMERDVFMSADEAKAYGLVDIVGDE 196
>CLPP_NITOC (Q3JAJ8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 30.8 bits (68), Expect = 3.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 E+I DT D FMS E+ YG++DS++ + Sbjct: 168 EKIQHDTDRDYFMSATESLAYGLVDSVLKQ 197
>CLPP_MAIZE (P26567) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + ED D FMS EAK YG++D + DE Sbjct: 169 VSEDMERDVFMSADEAKAYGLVDIVGDE 196
>CLPP2_CHLTR (O84712) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 30.8 bits (68), Expect = 3.2 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I ED+ D FM EA YG+ID +I K Sbjct: 163 EKIIEDSERDFFMGAEEAIAYGLIDKVISSAK 194
>CLPP2_CHLTA (Q3KKY8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 30.8 bits (68), Expect = 3.2 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I ED+ D FM EA YG+ID +I K Sbjct: 163 EKIIEDSERDFFMGAEEAIAYGLIDKVISSAK 194
>CLPP2_CHLPN (Q9Z759) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I ED+ D FM EA YG+ID ++ K Sbjct: 163 EKIIEDSERDFFMGAEEAISYGLIDKVVTSAK 194
>CLPP_THET8 (Q5SKM8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++++DT D ++S EA +YG+ID ++ Sbjct: 162 EKVEKDTDRDYYLSAQEALEYGLIDQVV 189
>CLPP_THET2 (Q72L15) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++++DT D ++S EA +YG+ID ++ Sbjct: 162 EKVEKDTDRDYYLSAQEALEYGLIDQVV 189
>CLPP_PHYPA (Q6YXM7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 30.8 bits (68), Expect = 3.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 I ED D FMS EAK YGI+D + E Sbjct: 170 ISEDMERDVFMSAQEAKTYGIVDLVAIE 197
>CLPP2_CORDI (Q6NFU4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 199 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 EQI +D+ D + + +AK+YGI+D +I+ + Sbjct: 163 EQITKDSDRDRWFTAQQAKEYGIVDHVIESAQ 194
>CLPP_VIBVY (Q7MMG7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FMS +A +YG++D+++ Sbjct: 168 EVIERDTDRDNFMSADQAVEYGLVDAVL 195
>CLPP_VIBVU (Q8DG26) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FMS +A +YG++D+++ Sbjct: 168 EVIERDTDRDNFMSADQAVEYGLVDAVL 195
>CLPP_VIBCH (Q9KQS6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+FMS +A +YG++D+++ Sbjct: 168 EVIERDTDRDNFMSADQAVEYGLVDAVL 195
>CLPP_THETN (Q8RC25) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 30.8 bits (68), Expect = 3.2 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I D D FM+ EAK YGIID I+ Sbjct: 163 EKIKADMERDYFMTAEEAKTYGIIDDIL 190
>CLPP_SILPO (Q5LUQ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 209 Score = 30.8 bits (68), Expect = 3.2 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 573 DSFMSPWEAKDYGIIDSIIDEGKLG 499 D+FMSP EAK++G ID I++ G Sbjct: 181 DNFMSPEEAKEWGHIDEIVESRSKG 205
>CLPP2_SYMTH (Q67QZ4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ ED+ D +MS EAK YG++D ++ Sbjct: 165 EKVKEDSERDRWMSAEEAKAYGLVDVVV 192
>CLPP1_CORDI (Q6NFU5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 209 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKL 502 EQ+ DT D ++ EA +YGI+D + D KL Sbjct: 175 EQVRIDTDRDKILTAEEAVEYGIVDQVFDYRKL 207
>CLPP_YERPS (Q66DT4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I+ DT D F+S ++ +YG++DS+ Sbjct: 176 EEIERDTERDRFLSAEQSVEYGLVDSV 202
>CLPP_YERPE (Q8ZC65) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 30.8 bits (68), Expect = 3.2 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I+ DT D F+S ++ +YG++DS+ Sbjct: 176 EEIERDTERDRFLSAEQSVEYGLVDSV 202
>CLPP_PINCO (P36387) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 205 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 603 EEQIDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 EE I D D FMS EA+ YGI+D + ++ Sbjct: 166 EEVIQRDLNRDVFMSATEAQAYGIVDVVAED 196
>CLPP_BURP1 (Q3JRC9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I DT D+FMS +AK YG+ID + Sbjct: 176 ERIARDTDRDNFMSSEDAKAYGLIDHV 202
>CLPP_BURMA (Q62JK7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 30.8 bits (68), Expect = 3.2 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I DT D+FMS +AK YG+ID + Sbjct: 176 ERIARDTDRDNFMSSEDAKAYGLIDHV 202
>CLPP_PSYAR (Q4FQB9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 225 Score = 30.4 bits (67), Expect = 4.1 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E+I++D D ++ EAK+YG+ID +++ Sbjct: 191 EKIEKDVERDYWLDAKEAKEYGLIDEVLE 219
>CLPP_OCEIH (Q8ENM5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 30.4 bits (67), Expect = 4.1 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E I+ DT D+FM+ ++ +YG+ID I++ Sbjct: 163 EVIERDTERDNFMTADQSVEYGLIDKILE 191
>VGLI_HHV2H (P13291) Glycoprotein I| Length = 372 Score = 30.4 bits (67), Expect = 4.1 Identities = 21/80 (26%), Positives = 38/80 (47%) Frame = +1 Query: 58 RTQNKPRGKLYSPTKGWLHCKINKSTVYRKNNITIQHTNSTTANLRVPARHTDLRPENCT 237 R +PRG++Y+P G + C +N++ + R H N+ P + + T Sbjct: 287 RRYRRPRGQIYNP--GGVSCAVNEAAMARLGAELRSHPNT-------PPKPRRRSSSSTT 337 Query: 238 L*ALACIASHIFDPNPMVML 297 + +L IA +P P+V+L Sbjct: 338 MPSLTSIAEE-SEPGPVVLL 356
>VGLI_HHV23 (P06764) Glycoprotein I| Length = 372 Score = 30.4 bits (67), Expect = 4.1 Identities = 21/80 (26%), Positives = 38/80 (47%) Frame = +1 Query: 58 RTQNKPRGKLYSPTKGWLHCKINKSTVYRKNNITIQHTNSTTANLRVPARHTDLRPENCT 237 R +PRG++Y+P G + C +N++ + R H N+ P + + T Sbjct: 287 RRYRRPRGQIYNP--GGVSCAVNEAAMARLGAELRSHPNT-------PPKPRRRSSSSTT 337 Query: 238 L*ALACIASHIFDPNPMVML 297 + +L IA +P P+V+L Sbjct: 338 MPSLTSIAEE-SEPGPVVLL 356
>CLPP_BACSU (P80244) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) (Caseinolytic protease) (Stress protein G7) Length = 197 Score = 30.4 bits (67), Expect = 4.1 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E I+ DT D+F S EA +YG+ID I+ Sbjct: 163 EVIERDTDRDNFKSAEEALEYGLIDKIL 190
>CLPP2_CHLMU (Q9PLM0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 30.4 bits (67), Expect = 4.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I ED+ D FM EA YG+ID ++ K Sbjct: 163 EKIIEDSERDFFMGAEEAIAYGLIDKVVSSAK 194
>CLPP_PHOLL (Q7N0L3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 30.4 bits (67), Expect = 4.1 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E+I +DT D F+S EA +YG++D I Sbjct: 176 EEIAKDTERDRFLSADEAVEYGLVDKI 202
>CLPP_THIDA (Q3SI98) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 212 Score = 30.0 bits (66), Expect = 5.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E ID DT D+FMS ++ YG++D ++ Sbjct: 177 EVIDRDTDRDNFMSAEDSVKYGLVDKVL 204
>ZN710_MOUSE (Q3U288) Zinc finger protein 710| Length = 666 Score = 30.0 bits (66), Expect = 5.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 332 RPHQLEICLTAYSITMGLGSKMWLAIQARAYNVQFSGR 219 RPH+ ++C A++ T L M L + + Y+ F GR Sbjct: 351 RPHKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGR 388
>CLPP2_BACHD (Q9K888) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 194 Score = 30.0 bits (66), Expect = 5.4 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ +D D FMS EA +YGI+D II Sbjct: 164 EKVAKDMDRDYFMSAEEALEYGIVDQII 191
>ZN710_HUMAN (Q8N1W2) Zinc finger protein 710| Length = 664 Score = 30.0 bits (66), Expect = 5.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 332 RPHQLEICLTAYSITMGLGSKMWLAIQARAYNVQFSGR 219 RPH+ ++C A++ T L M L + + Y+ F GR Sbjct: 349 RPHKCQVCHKAFTQTSHLKRHMLLHSEVKPYSCHFCGR 386
>CLPP2_RHILO (Q982V6) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 209 Score = 30.0 bits (66), Expect = 5.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I+ D FM+ EAKD+G+ID +I Sbjct: 171 EEIERTLDRDHFMTADEAKDFGLIDKVI 198
>CLPP_ADICA (Q85FJ8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 30.0 bits (66), Expect = 5.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 I ED D F+S EA+DYG++D + E Sbjct: 169 ISEDMERDVFLSAEEAQDYGVVDLVAVE 196
>CLPP2_CHLAB (Q5L4W7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 205 Score = 30.0 bits (66), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 E+I ED+ D FM +A YG+ID ++ K Sbjct: 165 EKIIEDSERDFFMGAEDAISYGLIDKVVSSAK 196
>CLPP_IDILO (Q5QXN8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 206 Score = 29.6 bits (65), Expect = 7.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++ DT D F+S E+ DYG++D I+ Sbjct: 172 EKVARDTDRDHFLSAEESIDYGLVDGIL 199
>CLPP2_LEIXX (Q6AFZ7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 223 Score = 29.6 bits (65), Expect = 7.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 EQ+++D D+ +S EA YG+ID ++ K Sbjct: 185 EQVNKDIERDNILSATEALKYGLIDQVLTSRK 216
>CLPP_BORPE (Q7VXI7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 29.6 bits (65), Expect = 7.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I DT D+FMS +A YG++D ++ Sbjct: 184 ERIAVDTERDNFMSAEDAVSYGLVDKVL 211
>CLPP_BORPA (Q7W8X2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 29.6 bits (65), Expect = 7.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I DT D+FMS +A YG++D ++ Sbjct: 184 ERIAVDTERDNFMSAEDAVSYGLVDKVL 211
>CLPP_BORBR (Q7WK83) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 29.6 bits (65), Expect = 7.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E+I DT D+FMS +A YG++D ++ Sbjct: 184 ERIAVDTERDNFMSAEDAVSYGLVDKVL 211
>CLPP1_CORJK (Q4JWV4) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 188 Score = 29.6 bits (65), Expect = 7.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGK 505 EQI +D+ D + + +AK+YG +D +I K Sbjct: 155 EQITKDSDRDRWFTAQQAKEYGFVDHVITSAK 186
>CLPP_HUPLU (Q5SD28) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 209 Score = 29.6 bits (65), Expect = 7.0 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 + EDT D F S EAK YG+ID + E Sbjct: 169 VSEDTERDVFTSAEEAKVYGVIDPVAVE 196
>CLPP_NEPOL (Q9TL09) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 29.3 bits (64), Expect = 9.2 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSI 520 E I D D FMSP +A+ YG+ID++ Sbjct: 166 ETIIIDLNRDLFMSPRQARSYGLIDAV 192
>CLPP1_PROAC (Q6A7F0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 216 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 EQI +D D +++ AK+YG+ID I+ Sbjct: 186 EQISKDIDRDKYLTAQGAKEYGLIDDIL 213
>URE1_BACSU (P77837) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 569 Score = 29.3 bits (64), Expect = 9.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 422 VGPEAFHKYHIRDFGGGTAPD 484 +G H YHI GGG APD Sbjct: 266 IGDRVIHTYHIEGAGGGHAPD 286
>CLPP_MARPO (P12208) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 29.3 bits (64), Expect = 9.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -1 Query: 594 IDEDTRFDSFMSPWEAKDYGIIDSIIDE 511 I ED D FMS EAK YGI+D + E Sbjct: 169 ISEDMERDVFMSAKEAKLYGIVDLVAIE 196
>CLPP_CLOPE (Q8XKK1) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 29.3 bits (64), Expect = 9.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIID 514 E+I D D FM EA +YG+ID +I+ Sbjct: 164 EKIKVDVERDYFMEASEAVEYGLIDKVIE 192
>CLPP2_AGRT5 (Q8UFY6) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 210 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSII 517 E++++ D FM EAKD+G+ID I+ Sbjct: 171 EEVEKTLDRDHFMDADEAKDWGVIDKIL 198
>CLPP2_TROW8 (Q83I18) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 207 Score = 29.3 bits (64), Expect = 9.2 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGL 496 +Q+ +D D +S +A +YG+ID I+ K GL Sbjct: 170 KQVSKDIDRDKILSSEQALEYGLIDQILVSRKAGL 204
>CLPP1_TROWT (Q83G49) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 207 Score = 29.3 bits (64), Expect = 9.2 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 600 EQIDEDTRFDSFMSPWEAKDYGIIDSIIDEGKLGL 496 +Q+ +D D +S +A +YG+ID I+ K GL Sbjct: 170 KQVSKDIDRDKILSSEQALEYGLIDQILVSRKAGL 204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,301,569 Number of Sequences: 219361 Number of extensions: 1863920 Number of successful extensions: 5004 Number of sequences better than 10.0: 217 Number of HSP's better than 10.0 without gapping: 4856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5001 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
