Clone Name | rbasd19g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENV_HV1Z8 (P05882) Envelope polyprotein GP160 precursor [Contain... | 32 | 1.6 | 2 | MURD_TROW8 (Q83HK0) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 30 | 3.6 | 3 | HFS1_HUMAN (O75562) Protein HFSE-1 | 30 | 6.2 | 4 | E2AK4_MOUSE (Q9QZ05) Eukaryotic translation initiation factor 2-... | 30 | 6.2 | 5 | E2AK4_HUMAN (Q9P2K8) Eukaryotic translation initiation factor 2-... | 29 | 8.1 |
---|
>ENV_HV1Z8 (P05882) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 863 Score = 31.6 bits (70), Expect = 1.6 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +3 Query: 336 PPLLGEPSVAVHATRCGEVEPHC----LINETCRSLTW-LDVIHSNHTI 467 PP G+P + H+ CG +C L N T S TW D ++S TI Sbjct: 373 PPAGGDPEITTHSFNCGGEFFYCNTSRLFNSTWNSSTWNNDTLNSEGTI 421
>MURD_TROW8 (Q83HK0) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 480 Score = 30.4 bits (67), Expect = 3.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 375 WHGRLRMALRAEEVHHVGTVGLCIYNV 295 WHG + RA+ + GT G C+YN+ Sbjct: 209 WHGAKELYYRAKSRVYHGTTGFCVYNL 235
>HFS1_HUMAN (O75562) Protein HFSE-1| Length = 157 Score = 29.6 bits (65), Expect = 6.2 Identities = 15/60 (25%), Positives = 30/60 (50%) Frame = +2 Query: 62 HNCISNAYAFQYATWIMERSFQNIDMYRE*LFTFYSFTNFESPWVSAPRVHANRACLRYF 241 H + N+Y +Q + M+ M R F + S + + W+++PRV +N+ R++ Sbjct: 18 HFRMVNSYDWQVVSGYMQEGSVPFHMARSIFFPYGSLSVHMALWMASPRVCSNQGSSRFY 77
>E2AK4_MOUSE (Q9QZ05) Eukaryotic translation initiation factor 2-alpha kinase 4| (EC 2.7.11.1) (GCN2-like protein) (mGCN2) Length = 1648 Score = 29.6 bits (65), Expect = 6.2 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 357 SVAVHATRCGEVEPHCLINETCRSLTWLDVIHSNHTIA*HAIL 485 S+A H + G V H L T + L LD +HSN + H +L Sbjct: 385 SLATHLSHSGPVPAHQLRKYTAQLLAGLDYLHSNSVV--HKVL 425
>E2AK4_HUMAN (Q9P2K8) Eukaryotic translation initiation factor 2-alpha kinase 4| (EC 2.7.11.1) (GCN2-like protein) Length = 1649 Score = 29.3 bits (64), Expect = 8.1 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 357 SVAVHATRCGEVEPHCLINETCRSLTWLDVIHSNHTIA*HAIL 485 S+A H + G + H L T + L+ LD +HSN + H +L Sbjct: 386 SLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNSVV--HKVL 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,158,868 Number of Sequences: 219361 Number of extensions: 1999143 Number of successful extensions: 5080 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5074 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)