| Clone Name | rbasd19d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACLY_HUMAN (P53396) ATP-citrate synthase (EC 2.3.3.8) (ATP-citra... | 33 | 1.0 | 2 | ACLY_MOUSE (Q91V92) ATP-citrate synthase (EC 2.3.3.8) (ATP-citra... | 33 | 1.0 | 3 | ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late ... | 30 | 6.7 | 4 | SYT_SULTO (Q973C8) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threon... | 30 | 8.8 |
|---|
>ACLY_HUMAN (P53396) ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate| (pro-S-)-lyase) (Citrate cleavage enzyme) Length = 1101 Score = 32.7 bits (73), Expect = 1.0 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +1 Query: 52 SGMVVQIHTSPTHMSFIYSSNVGIVAQHRPYPHLQVHSSHSAYF-FRKKATTRYIVPTFT 228 +G+ + + + THM+ I VG+ HRP P+ ++H+A F +T P+ T Sbjct: 398 TGIPIHVFGTETHMTAI----VGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRT 453 Query: 229 SY*GSKDGRAEEVASSSR 282 + + RA+EVA + + Sbjct: 454 A--SFSESRADEVAPAKK 469
>ACLY_MOUSE (Q91V92) ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate| (pro-S-)-lyase) (Citrate cleavage enzyme) Length = 1091 Score = 32.7 bits (73), Expect = 1.0 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +1 Query: 52 SGMVVQIHTSPTHMSFIYSSNVGIVAQHRPYPHLQVHSSHSAYF-FRKKATTRYIVPTFT 228 +G+ + + + THM+ I VG+ HRP P+ ++H+A F +T P+ T Sbjct: 398 TGIPIHVFGTETHMTAI----VGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRT 453 Query: 229 SY*GSKDGRAEEVASSSR 282 + + RA+EVA + + Sbjct: 454 A--SFSESRADEVAPAKK 469
>ADEN_ADEB4 (O71150) Adenain (EC 3.4.22.39) (Endoprotease) (Late L3 23 kDa| protein) Length = 201 Score = 30.0 bits (66), Expect = 6.7 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 534 RNLNDASPAQRPCDPSSYHESSD 602 ++LN ASP+ P DPSS H++ D Sbjct: 147 QSLNGASPSLTPSDPSSLHKNQD 169
>SYT_SULTO (Q973C8) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 540 Score = 29.6 bits (65), Expect = 8.8 Identities = 27/113 (23%), Positives = 47/113 (41%) Frame = +1 Query: 40 YILYSGMVVQIHTSPTHMSFIYSSNVGIVAQHRPYPHLQVHSSHSAYFFRKKATTRYIVP 219 YI ++G +++ P+ + Y + I + H P P++Q F +K+ +Y+ Sbjct: 68 YIEFNGNKIKVLGEPSSLEPKYFEILNI-SVHHPSPNVQYVRIRGVGFEKKEELDQYLK- 125 Query: 220 TFTSY*GSKDGRAEEVASSSRLALQWILVKGFRLYSFQLPDTNAPGIVIYCHY 378 EEV+ + G RL F PD APG+ ++ HY Sbjct: 126 -----------WLEEVSEYDHRII------GERLDLFSFPDETAPGLALF-HY 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,284,604 Number of Sequences: 219361 Number of extensions: 2176877 Number of successful extensions: 4285 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4285 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)