ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd18n10 |
|---|---|
| Clone Library Name | barley_pub |
>UBC12_ARATH (Q9SDY5) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme 1) (RUB1-protein ligase 1) (RUB1 carrier protein 1) Length = 184 Score = 78.2 bits (191), Expect = 1e-14 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF++PN EDPLNH+AAAVLRDNP+ F+ NV+ AM+GGYV T FPRC Sbjct: 133 GLFHLFTEPNSEDPLNHDAAAVLRDNPKLFETNVRRAMTGGYVGQTFFPRC 183
>UB12L_ARATH (Q9ZU75) Probable NEDD8-conjugating enzyme Ubc12-like (EC 6.3.2.-)| (RUB1-conjugating enzyme 2) (RUB1-protein ligase 2) (RUB1 carrier protein 2) Length = 185 Score = 74.3 bits (181), Expect = 2e-13 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF++PN EDPLNHEAAAVLRDNP+ F+ NV+ AM GG V T FPRC Sbjct: 134 GLFHLFTEPNYEDPLNHEAAAVLRDNPKTFEYNVRRAMMGGQVGQTSFPRC 184
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF +PN EDPLN EAA VL++N + F++NVQ +M GGY+ +T+F RC Sbjct: 131 GLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERC 181
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF +PN EDPLN EAA VL++N + F++NVQ +M GGY+ +T+F RC Sbjct: 131 GLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERC 181
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF +PN EDPLN EAA VL++N + F++NVQ +M GGY+ +T+F RC Sbjct: 131 GLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERC 181
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF +PN EDPLN EAA VL++N + F++NVQ +M GGY+ +T+F RC Sbjct: 131 GLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERC 181
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 58.9 bits (141), Expect = 7e-09 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPRC 333 GL LF +PN EDPLN EAA VL+ N ++F+ NV+ AM GG V T+F C Sbjct: 128 GLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECC 178
>UBC12_SCHPO (O74549) NEDD8-conjugating enzyme ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 177 Score = 51.2 bits (121), Expect = 1e-06 Identities = 26/48 (54%), Positives = 29/48 (60%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHF 342 GL LF PN EDPLN EAAA L +PQ F V+ AM GG V+ F Sbjct: 125 GLQFLFLSPNAEDPLNKEAAADLHKDPQGFASRVRTAMKGGLVNGISF 172
>UBC12_ASHGO (Q75AF2) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 48.9 bits (115), Expect = 7e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHF 342 GL LF +PN DPLN +AA + +P +F+ NVQ M GG++D F Sbjct: 132 GLLFLFLEPNGSDPLNRQAADTMLRDPYRFETNVQATMMGGHLDGQVF 179
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 46.6 bits (109), Expect = 4e-05 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHF 342 GL LF +PN DPLN +AA + N ++F+RNV+ +M+GG V F Sbjct: 126 GLQYLFLEPNASDPLNKDAAHQMTANREEFKRNVKHSMAGGSVAGERF 173
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 46.6 bits (109), Expect = 4e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHF 342 GL LF +PN DPLN EAA VL + +F V++AMSG V +T++ Sbjct: 136 GLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAMSGAMVGSTYY 183
>UBC12_YEAST (P52491) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 188 Score = 43.9 bits (102), Expect = 2e-04 Identities = 19/48 (39%), Positives = 31/48 (64%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHF 342 GL LF +PN DPLN +AA +L + ++F V++ MSGG +++ + Sbjct: 135 GLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTMSGGSIEHVKY 182
>UBC12_KLULA (Q6CSW8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 42.0 bits (97), Expect = 9e-04 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFPR 336 G+ LF +PN DPLN +AA L ++P +F+ V ++ G +D + + Sbjct: 132 GILFLFHEPNGRDPLNKDAAKTLIEDPLRFENKVNHSLRGNNIDGVWYDK 181
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 37.7 bits (86), Expect = 0.016 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQ 381 + S PNDE P N +AA R+NPQ+F++ V+ Sbjct: 127 MLSSPNDESPANIDAAKEFRENPQEFKKRVR 157
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 34.7 bits (78), Expect = 0.14 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDNTHFP 339 L PN P N EAA++ R+N +++ R V+ + ++D+ P Sbjct: 112 LLHDPNPNSPANAEAASLYRENMKEYVRRVKATVEASWLDDGEMP 156
>UB2L6_MOUSE (Q9QZU9) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 33.5 bits (75), Expect = 0.31 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = -1 Query: 482 LNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQ 381 LN+L S+PN E+P+ E A +L NP+ F++ + Sbjct: 107 LNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAE 140
>UB2L6_HUMAN (O14933) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 33.1 bits (74), Expect = 0.40 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 482 LNLLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQ 381 LN+L ++PN +PL + A +L NP+ F++N + Sbjct: 107 LNVLVNRPNIREPLRMDLADLLTQNPELFRKNAE 140
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 32.7 bits (73), Expect = 0.53 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNV 384 + S PNDE P N EAA RDN +F++ V Sbjct: 127 MLSGPNDESPANVEAAKEWRDNRAEFRKKV 156
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 32.7 bits (73), Expect = 0.53 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 L + PN P N +AA + ++N ++++R V+ + +VDN Sbjct: 112 LLNDPNPASPANVDAAQLFKENLKEYERRVKKTVELSWVDN 152
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 32.0 bits (71), Expect = 0.90 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAM 372 + S PNDE P N EAA R+ +F++ V+ A+ Sbjct: 128 MLSSPNDESPANIEAAKDWREKQDEFKKKVRRAV 161
>UBC2_CANGA (Q6FR76) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 167 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 LF+ PN P N EAA + +D+ ++ + V+ + + DN Sbjct: 112 LFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSWEDN 152
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 31.2 bits (69), Expect = 1.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVD 354 L S PN P N AA + ++N +++++ V+ + ++D Sbjct: 112 LLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID 151
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNV 384 + S PNDE P N EAA RD +F++ V Sbjct: 126 MLSGPNDESPANVEAAKEWRDKRDEFKKKV 155
>SYT_STRA5 (Q8E0L9) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 647 Score = 30.8 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +3 Query: 303 TYQASPPALLAPWEMGVIDIASRHRHLDVSLELLRVVSEDG 425 TY+ + P LAP ++ VI I S H+D + E+ RV+ + G Sbjct: 532 TYKGAFPTWLAPQQVSVIPI-SNEAHIDYAWEVARVLKDRG 571
>SYT_STRA3 (Q8E693) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 647 Score = 30.8 bits (68), Expect = 2.0 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +3 Query: 303 TYQASPPALLAPWEMGVIDIASRHRHLDVSLELLRVVSEDG 425 TY+ + P LAP ++ VI I S H+D + E+ RV+ + G Sbjct: 532 TYKGAFPTWLAPQQVSVIPI-SNEAHIDYAWEVARVLKDRG 571
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 30.4 bits (67), Expect = 2.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -1 Query: 476 LLFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQ 381 +L QPN EDP N E A++ R++ + + ++ Sbjct: 115 VLLDQPNPEDPFNSELASLYRNDKLSYDKKIR 146
>LBD18_ARATH (O22131) LOB domain protein 18| Length = 262 Score = 30.4 bits (67), Expect = 2.6 Identities = 39/158 (24%), Positives = 61/158 (38%), Gaps = 3/158 (1%) Frame = +1 Query: 16 FDXXXXXXXFSARYRRVSLHNVTTFLLHVTRQFQNIHQTSTTAVTSS*HKQV**IHFLGM 195 FD F+A ++ NV+ LLH+ +H+ S VT Q Sbjct: 58 FDSEQGSAYFAAVHKVFGASNVSKLLLHIP-----VHRRSDAVVTICYEAQA-----RIR 107 Query: 196 PSAFLQIVQCLALKGRVGGRKPEASTYQARLPALLARTRPARPLYLHLGKWVLST*PPDI 375 + + AL+ +V + E S QA L +L RP + + + T PP + Sbjct: 108 DPIYGCVAHIFALQQQVVNLQAEVSYLQAHLASLELPQPQTRPQPMPQPQPLFFTPPPPL 167 Query: 376 AIWTFLWNFCGLSRRTAAAS*FN---GSSSLGCEKRRF 480 AI + L AS F+ SS+ ++RRF Sbjct: 168 AITDLPASVSPLPSTYDLASIFDQTTSSSAWATQQRRF 205
>UBC2_ASHGO (Q75EB8) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 170 Score = 30.0 bits (66), Expect = 3.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 LF+ PN P N EAA + +D+ ++ + V+ + + D+ Sbjct: 112 LFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDD 152
>LMO6_MOUSE (Q80VL3) LIM domain only protein 6 (Triple LIM domain protein 6)| Length = 624 Score = 30.0 bits (66), Expect = 3.4 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 260 QKQAHTRPACPPYLHVPGQPARFTCTLGNGCYRHSLQTSPSGRFSGTS 403 ++Q H R + H PG+ C LG+G S +SPS S +S Sbjct: 519 RRQRHRRRGSHHHHHHPGRHGHHRCDLGSGSDSGSCSSSPSSPSSESS 566
>UBC2_YEAST (P06104) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 172 Score = 30.0 bits (66), Expect = 3.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 LF+ PN P N EAA + +D+ ++ + V+ + + D+ Sbjct: 112 LFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDD 152
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 30.0 bits (66), Expect = 3.4 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVD 354 L + PN P N EA+ + +D+ Q++++ V+ + + D Sbjct: 112 LLNDPNTSSPANVEASMLYKDHRQQYEKRVRDTVEASWTD 151
>UBC2_KLULA (Q6CUD9) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 164 Score = 29.6 bits (65), Expect = 4.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 LF+ PN P N EAA + +D+ ++ + V+ + + D+ Sbjct: 112 LFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKSWEDD 152
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 29.3 bits (64), Expect = 5.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYV 357 L PN + P N EAA + +N +++ R V + YV Sbjct: 112 LLCDPNPDSPANAEAARLFSENKREYNRKVIEIVEQSYV 150
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 29.3 bits (64), Expect = 5.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNV 384 + S PNDE P N EAA R+ +F++ V Sbjct: 126 MLSGPNDESPANVEAAKEWREKRDEFKKKV 155
>UBC7_YEAST (Q02159) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 165 Score = 29.3 bits (64), Expect = 5.8 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAM 372 + S+PN E N +A + RDN +F+R V++++ Sbjct: 126 MLSEPNIESGANIDACILWRDNRPEFERQVKLSI 159
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAA-VLRDNPQKFQR 390 L PN DPLN EAAA ++RD P QR Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPTYEQR 138
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 29.3 bits (64), Expect = 5.8 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQ 381 L + PN DPLN +AAA+ P+++++ ++ Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIK 142
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 29.3 bits (64), Expect = 5.8 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQ 381 L + PN DPLN +AAA+ P+++++ ++ Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIK 142
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAA-VLRDNPQKFQR 390 L PN DPLN EAAA ++RD P QR Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQR 138
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 29.3 bits (64), Expect = 5.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGY 360 L + PN+ P N EAA + R+N +++ R V+ + + Sbjct: 112 LLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSW 149
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 29.3 bits (64), Expect = 5.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQM 378 L PN P N +AA R NP+++++ V+M Sbjct: 131 LLEDPNINSPANVDAAVDYRKNPEQYKQRVKM 162
>FETUA_PANTR (Q9N2D0) Alpha-2-HS-glycoprotein precursor (Fetuin-A) [Contains:| Alpha-2-HS-glycoprotein chain A; Alpha-2-HS-glycoprotein chain B] Length = 367 Score = 28.9 bits (63), Expect = 7.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 485 GLNLLFSQPNDEDPLNHEAAAVLRD 411 GL L++ QPN +DP EAA V D Sbjct: 22 GLGLIYRQPNCDDPETEEAALVAID 46
>WRIP1_RAT (Q8CG07) ATPase WRNIP1 (Werner helicase-interacting protein 1)| Length = 660 Score = 28.9 bits (63), Expect = 7.6 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +1 Query: 181 HFLGMPSAFLQIVQCLALKGRVGGRKPEASTYQARLPALLARTRPARPLYLHL 339 HF+GMP + + QC+ R S Y L + P P+ LHL Sbjct: 561 HFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRSHQGPLPPVPLHL 613
>WRIP1_MOUSE (Q91XU0) ATPase WRNIP1 (Werner helicase-interacting protein 1)| Length = 660 Score = 28.9 bits (63), Expect = 7.6 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +1 Query: 181 HFLGMPSAFLQIVQCLALKGRVGGRKPEASTYQARLPALLARTRPARPLYLHL 339 HF+GMP + + QC+ R S Y L + P P+ LHL Sbjct: 561 HFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRSHQGPLPPVPLHL 613
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 28.5 bits (62), Expect = 9.9 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 L +PN P N +AA + ++N +++++ V + + D+ Sbjct: 112 LLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS 152
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 28.5 bits (62), Expect = 9.9 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 L +PN P N +AA + ++N +++++ V + + D+ Sbjct: 112 LLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS 152
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 28.5 bits (62), Expect = 9.9 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 L +PN P N +AA + ++N +++++ V + + D+ Sbjct: 112 LLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS 152
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 28.5 bits (62), Expect = 9.9 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -1 Query: 473 LFSQPNDEDPLNHEAAAVLRDNPQKFQRNVQMAMSGGYVDN 351 L +PN P N +AA + ++N +++++ V + + D+ Sbjct: 112 LLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,546,503 Number of Sequences: 219361 Number of extensions: 1793462 Number of successful extensions: 4860 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 4636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4859 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
