| Clone Name | rbasd18m24 |
|---|---|
| Clone Library Name | barley_pub |
>UPK3B_HUMAN (Q9BT76) Uroplakin-3B precursor (Uroplakin IIIb) (UPIIIb) (p35)| Length = 320 Score = 32.7 bits (73), Expect = 0.63 Identities = 20/61 (32%), Positives = 24/61 (39%) Frame = +2 Query: 338 DCSQPEQAQGGPAAVLSPWARRCLPDGR*SSLQEEHCPVRRSWRMGGSPAAISCASSLRP 517 D S Q GGPA V+ PWA P+R G+P +S A L P Sbjct: 36 DASSQTQGAGGPAGVIGPWA---------------PAPLRLGEAAPGTPTPVSVAHLLSP 80 Query: 518 V 520 V Sbjct: 81 V 81
>CABL1_MOUSE (Q9ESJ1) CDK5 and ABL1 enzyme substrate 1 (Interactor with CDK3 1)| (Ik3-1) Length = 568 Score = 31.6 bits (70), Expect = 1.4 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = +2 Query: 320 RSNHQEDCSQPEQAQGGPAAVLSPW--ARRCLPDGR*SSLQ-----EEHCPVRRSWRMGG 478 R N Q C+ + QGG + L ARR L R SSL+ EE+ P+RR + G Sbjct: 215 RQNSQNYCALEQSGQGGSTSALEQLQRARRRLISQR-SSLETLEDIEENAPLRRCRTLSG 273 Query: 479 SP 484 SP Sbjct: 274 SP 275
>ZIC5_HUMAN (Q96T25) Zinc finger protein ZIC 5 (Zinc finger protein of the| cerebellum 5) Length = 639 Score = 25.8 bits (55), Expect(2) = 1.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 284 PPPPKPSFLAKFCPCLAGGGATS 216 PPPP P L+ + +GGG +S Sbjct: 143 PPPPPPPALSGYTTTNSGGGGSS 165 Score = 23.9 bits (50), Expect(2) = 1.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 332 GDYFVGRPSNHEQNTTPPPPKP 267 G Y G S+ Q + PPPP P Sbjct: 110 GSYPCGGGSSGAQPSAPPPPAP 131
>ICAM5_HUMAN (Q9UMF0) Intercellular adhesion molecule 5 precursor (ICAM-5)| (Telencephalin) Length = 924 Score = 30.4 bits (67), Expect = 3.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 431 LQEEHCPVRRSWRMGGSPAAISCASSLRPVP 523 + E CP ++W G +A++CA+ RP P Sbjct: 668 MDESTCPSHQTWLEGAEASALACAARGRPSP 698
>RLUB_XANCP (Q8P8M6) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 492 Score = 29.6 bits (65), Expect = 5.3 Identities = 21/42 (50%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -2 Query: 521 GQG-GERKHS*SQPENRPSAMSDGQGNAPPG--GYFIGRPAN 405 GQG G+RKH P N PS SD +A PG Y RPAN Sbjct: 444 GQGQGQRKHPYGHPGNAPSFPSD---HANPGFSPYGAARPAN 482
>ICAM5_MOUSE (Q60625) Intercellular adhesion molecule 5 precursor (ICAM-5)| (Telencephalin) Length = 917 Score = 29.3 bits (64), Expect = 7.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 431 LQEEHCPVRRSWRMGGSPAAISCASSLRPVP 523 + E CP ++W G A++C++ RP P Sbjct: 667 MDESSCPSHQTWLEGAEATALACSARGRPSP 697
>CRLS1_RAT (Q5U2V5) Cardiolipin synthetase (EC 2.7.8.-) (Cardiolipin synthase)| (CLS) Length = 302 Score = 29.3 bits (64), Expect = 7.0 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 7/64 (10%) Frame = -1 Query: 450 GQCSSWRLLHRPSGKHRRAQGERTAAGPP*ACS-GCEQSSW*L------LRRPPVKPRAE 292 G S R+ RP G G R A PP AC GC W L LR P PR Sbjct: 9 GAWGSLRVAVRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGTSPRTH 68 Query: 291 HDAA 280 A Sbjct: 69 CSGA 72
>GBX2_CHICK (O42230) Homeobox protein GBX-2 (Gastrulation and brain-specific| homeobox protein 2) Length = 340 Score = 28.9 bits (63), Expect = 9.1 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 284 PPPPKPSFLAKFCPCLAGGGATS*T 210 PPPP P+ FCP LA G A + T Sbjct: 75 PPPPLPALPGAFCPGLAQGMALTST 99
>UL47_HHV11 (P10231) Virion protein UL47 (82/81 kDa tegument protein)| (VMW82/81) (VP13/14) Length = 693 Score = 28.9 bits (63), Expect = 9.1 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -1 Query: 528 GHGTGRREEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQGER 382 G E + +A EPP+R R + R P HRRA +R Sbjct: 43 GDDDSELEALEEMAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQR 91
>PCD15_HUMAN (Q96QU1) Protocadherin-15 precursor| Length = 1955 Score = 28.9 bits (63), Expect = 9.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 284 PPPPKPSFLAKFCPCLAGGGATS 216 PPPP SFL+ C C+ G T+ Sbjct: 1828 PPPPSASFLSTECVCITGVKCTT 1850
>UL47_HHV1F (P08313) Virion protein UL47 (82/81 kDa tegument protein)| (VMW82/81) (VP13/14) Length = 664 Score = 28.9 bits (63), Expect = 9.1 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -1 Query: 528 GHGTGRREEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQGER 382 G E + +A EPP+R R + R P HRRA +R Sbjct: 43 GDDDSELEALEEMAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQR 91
>P85B_RAT (Q63788) Phosphatidylinositol 3-kinase regulatory beta subunit| (PI3-kinase p85-beta subunit) (PtdIns-3-kinase p85-beta) Length = 722 Score = 28.9 bits (63), Expect = 9.1 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -2 Query: 299 EQNTTPP--PPKPSFLAKFCPCLAGGGAT 219 EQ+T PP PPKPS + LA GG+T Sbjct: 288 EQDTAPPALPPKPSKVKPAPTALANGGST 316 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,358,461 Number of Sequences: 219361 Number of extensions: 1664253 Number of successful extensions: 4938 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4923 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)