Clone Name | rbasd18m17 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DNBI_MCMVS (P30672) Major DNA-binding protein (MDBP) | 32 | 1.5 | 2 | HUTU_HUMAN (Q96N76) Probable urocanate hydratase (EC 4.2.1.49) (... | 31 | 3.5 | 3 | ATG19_YEAST (P35193) Autophagy-related protein 19 (Cytoplasm-to-... | 30 | 7.7 |
---|
>DNBI_MCMVS (P30672) Major DNA-binding protein (MDBP)| Length = 1191 Score = 32.3 bits (72), Expect = 1.5 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -3 Query: 589 VFYLLQAPWGGLLQVCRKTEVIDAGYEELIVETNK 485 +FY + WG L+VC + +I+AG ++ + +T + Sbjct: 228 LFYFMFTSWGQSLRVCETSRLIEAGLQQFVEDTQQ 262
>HUTU_HUMAN (Q96N76) Probable urocanate hydratase (EC 4.2.1.49) (Urocanase)| (Imidazolonepropionate hydrolase) Length = 676 Score = 31.2 bits (69), Expect = 3.5 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = -3 Query: 556 LLQVCRKTEVIDAGYEELIVETNKILLHKVDMEAEDLVEINSLH---HNVLFLGRNQPIC 386 L + +K EV+ GY +V + L+H++D E LV++ S HN F G P+ Sbjct: 300 LREARKKKEVLSLGYHGNVVALWERLVHELDTTGECLVDLGSDQTSCHNP-FNGGYYPVQ 358 Query: 385 LSAEEYPQLKAN 350 LS E L A+ Sbjct: 359 LSFTEAQSLMAS 370
>ATG19_YEAST (P35193) Autophagy-related protein 19 (Cytoplasm-to-vacuole| targeting protein 19) Length = 415 Score = 30.0 bits (66), Expect = 7.7 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 5/85 (5%) Frame = -3 Query: 535 TEVIDAGYEELIVETNK---ILLHKVDMEAEDLVEINSLHHNVLFLGR--NQPICLSAEE 371 T++ID G E+ ++ K + +D+EA +EI + + V+FLG+ + P+ ++ Sbjct: 302 TQIIDMGPHEIGIKEYKEYRYFPYALDLEAGSTIEIENQYGEVIFLGKYGSSPM-INLRP 360 Query: 370 YPQLKANCVYFADDEQYNWMYKTNP 296 +L A + + + Y++ T P Sbjct: 361 PSRLSAESLQASQEPFYSFQIDTLP 385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,533,057 Number of Sequences: 219361 Number of extensions: 2369803 Number of successful extensions: 5492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5489 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7592921998 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)