Clone Name | rbasd18m10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TCF17_MOUSE (Q61751) Zinc finger protein 354A (Transcription fac... | 30 | 4.4 | 2 | GCP3_XENLA (O73787) Gamma-tubulin complex component 3 homolog (G... | 29 | 7.5 |
---|
>TCF17_MOUSE (Q61751) Zinc finger protein 354A (Transcription factor 17) (Renal| transcription factor Kid-1) (Kidney, ischemia, and developmentally-regulated protein 1) Length = 572 Score = 30.0 bits (66), Expect = 4.4 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +2 Query: 314 CQLRVSKAYVACDARFFQTLCRFNRKQTEENQKSENISGVQSRVEE 451 C R +K+ D+ F + + R ++++ N KSEN+S + ++EE Sbjct: 89 CSQRTTKSTQTQDSSFRELIMRKSKRKEPWNMKSENLSIHEGKLEE 134
>GCP3_XENLA (O73787) Gamma-tubulin complex component 3 homolog (Gamma ring| complex protein 109) (Xgrip109) (x109p) Length = 906 Score = 29.3 bits (64), Expect = 7.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 373 LQIQQKTNRRESEK*KYIRGPVQG*RGSRLQEFRHQIPSCRSNCR 507 LQ +++ RESE + + R+QEF+ IP RS R Sbjct: 803 LQFEERKKERESEGEWGVTAAEEDVENKRIQEFQESIPKMRSQLR 847 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,520,424 Number of Sequences: 219361 Number of extensions: 1332666 Number of successful extensions: 2901 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2896 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)