Clone Name | rbasd18j09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MMRN2_HUMAN (Q9H8L6) Multimerin-2 precursor (EMILIN-3) (Elastin ... | 28 | 6.7 | 2 | R1AB_CVPPU (Q9IW06) Replicase polyprotein 1ab (pp1ab) (ORF1ab po... | 28 | 8.8 |
---|
>MMRN2_HUMAN (Q9H8L6) Multimerin-2 precursor (EMILIN-3) (Elastin microfibril| interface located protein 3) (Elastin microfibril interfacer 3) (EndoGlyx-1 p125/p140 subunit) Length = 949 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 268 NFPHSIVRDLPGIWKRSPGDRRMKSMKEMSTG 363 N H + LPG+WK PG+ M+ TG Sbjct: 186 NDVHRVADSLPGLWKALPGNLTAAVMEANQTG 217
>R1AB_CVPPU (Q9IW06) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p9; p87; p195 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2; Unknown protein 1; 3C-like Length = 6684 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -1 Query: 134 CYSFFCYFSLFGSCCLLISSSMLVITANSTCYMVESREIYTV 9 CY + +FG C LI ++ + N+ Y V + + Sbjct: 2682 CYGVLKFKKIFGDCTFLIVMIIVTLVVNNVSYFVTQNTFFMI 2723 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,441,224 Number of Sequences: 219361 Number of extensions: 547240 Number of successful extensions: 2268 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)