| Clone Name | rbasd18h14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAD23_HUMAN (Q9H251) Cadherin-23 precursor (Otocadherin) | 29 | 3.8 | 2 | HNF3G_HUMAN (P55318) Hepatocyte nuclear factor 3-gamma (HNF-3G) ... | 28 | 8.6 |
|---|
>CAD23_HUMAN (Q9H251) Cadherin-23 precursor (Otocadherin)| Length = 3354 Score = 28.9 bits (63), Expect = 3.8 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 86 NKTGMTDXDEGADSYSFYFLCCNXKTRXYRMMSMPCTAV 202 N TG D DEG ++ +YF+ + + + + C V Sbjct: 2749 NVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQPDGCLLV 2787
>HNF3G_HUMAN (P55318) Hepatocyte nuclear factor 3-gamma (HNF-3G) (Forkhead box| protein A3) (Fork head-related protein FKH H3) Length = 350 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 7 PXPAAHGXEHQGQASCGKPXASLP 78 P P A G E G CG P +S P Sbjct: 258 PEPEAQGGEDVGALDCGSPASSTP 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,148,333 Number of Sequences: 219361 Number of extensions: 231342 Number of successful extensions: 385 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)