Clone Name | rbasd18g15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | REPS1_MOUSE (O54916) RalBP1-associated Eps domain-containing pro... | 37 | 0.067 | 2 | PUR9_RHIME (Q92KX6) Bifunctional purine biosynthesis protein pur... | 32 | 2.2 | 3 | FADB_ACIAD (Q6FF68) Fatty oxidation complex alpha subunit [Inclu... | 30 | 6.3 | 4 | REPS1_HUMAN (Q96D71) RalBP1-associated Eps domain-containing pro... | 30 | 8.2 |
---|
>REPS1_MOUSE (O54916) RalBP1-associated Eps domain-containing protein 1| (RalBP1-interacting protein 1) Length = 743 Score = 36.6 bits (83), Expect = 0.067 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 7/77 (9%) Frame = +2 Query: 296 ALIHKAPLRCPPAQIHLEAQWRLPSSQDHKRP*TQL*ALSSLLPHRHN-------PSSST 454 A++H P+R P++IH++ +S DH P + L S L + PS +T Sbjct: 397 AIVHPVPIRMTPSKIHMQEMELKRTSSDHTNPTSPLLVKPSDLSEENKINSSVKFPSGNT 456 Query: 455 LNSIQMAYQHPSDHQRI 505 ++ + PSD ++I Sbjct: 457 VDGYSSSDSFPSDPEQI 473
>PUR9_RHIME (Q92KX6) Bifunctional purine biosynthesis protein purH [Includes:| Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] Length = 536 Score = 31.6 bits (70), Expect = 2.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -3 Query: 213 AWACDSDGASGASLGIDEKLSAETEGHASKLSRISFLAPIVS 88 A ACDS A G + ++++L AET KL +AP VS Sbjct: 307 ALACDSTSAFGGIIALNQELDAETAEEIVKLFTEVIIAPSVS 348
>FADB_ACIAD (Q6FF68) Fatty oxidation complex alpha subunit [Includes: Enoyl-CoA| hydratase (EC 4.2.1.17); Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase (EC 5.3.3.8); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35); 3-hydroxybutyryl-CoA epimerase (EC 5.1.2. Length = 717 Score = 30.0 bits (66), Expect = 6.3 Identities = 21/51 (41%), Positives = 23/51 (45%) Frame = -3 Query: 186 SGASLGIDEKLSAETEGHASKLSRISFLAPIVSAPVGLVALLLATPSIKST 34 +GASLG DE L ETEG A A I L+ L L IK T Sbjct: 262 AGASLGRDEALKVETEGFAK--------AAITPQAEALIGLFLNDQIIKKT 304
>REPS1_HUMAN (Q96D71) RalBP1-associated Eps domain-containing protein 1| (RalBP1-interacting protein 1) Length = 744 Score = 29.6 bits (65), Expect = 8.2 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 296 ALIHKAPLRCPPAQIHLEAQWRLPSSQDHKRP*TQL*ALSSLLPHRHNPSSS 451 A++H P+R P++IH++ + DH P + L S L + +SS Sbjct: 397 AIVHPVPIRMTPSKIHMQEMELKRTGSDHTNPTSPLLVKPSDLLEENKINSS 448 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,250,095 Number of Sequences: 219361 Number of extensions: 1947439 Number of successful extensions: 5385 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5384 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)