Clone Name | rbasd17l03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALP1_YEAST (P38971) Basic amino-acid permease | 29 | 9.8 |
---|
>ALP1_YEAST (P38971) Basic amino-acid permease| Length = 573 Score = 29.3 bits (64), Expect = 9.8 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 77 LLSSVLCKYMVNLLLPYYTPRMHSDTIHTSSS 172 L+ +L + + LL+PY P++ SD I SSS Sbjct: 312 LVFYILSLFFIGLLVPYNDPKLDSDGIFVSSS 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,054,541 Number of Sequences: 219361 Number of extensions: 1401354 Number of successful extensions: 3212 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3211 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)