ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd17k13 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 89.4 bits (220), Expect = 2e-18 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 208 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA Sbjct: 73 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 88.2 bits (217), Expect = 5e-18 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 208 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGC+ESGKA Sbjct: 134 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 87.8 bits (216), Expect = 6e-18 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 208 EVKKEYPDAYVR+IGFDNMRQVQCVSFIAF+PPGCEESGKA Sbjct: 135 EVKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 86.7 bits (213), Expect = 1e-17 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 208 EVKKEYPDAYVR+IGFDN+RQVQCVSFIAF+PPGCEESGKA Sbjct: 134 EVKKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 77.4 bits (189), Expect = 8e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 208 EV+KEYPD Y RIIGFDNMRQVQ VSFIA KPPGCEESGKA Sbjct: 135 EVRKEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 73.6 bits (179), Expect = 1e-13 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 214 E KK YPDA+VRIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 135 EAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 214 E KK YPDA++RIIGFDN+RQVQ +SFIA+KPPGCEESG Sbjct: 135 EAKKAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 64.3 bits (155), Expect = 7e-11 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN RQVQCVSFIAFKPPG Sbjct: 146 EAKKAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESG 214 E KK YPDA+VRIIGFDN+RQVQ +SFIA+ PGCEESG Sbjct: 133 EAKKAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP+A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 146 EAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP+A++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 146 EAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E KKEYP A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 144 ECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E KKEYP A++RIIGFDN RQVQC+SFIA+KPP E+ Sbjct: 144 ECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 62.8 bits (151), Expect = 2e-10 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E KKEYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 144 ECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 62.8 bits (151), Expect = 2e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KKEYPDA++R+IGFDN+RQVQC+SFIA+KP Sbjct: 148 EAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 62.4 bits (150), Expect = 3e-10 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E KKEYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 45 ECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPP 77
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 62.0 bits (149), Expect = 4e-10 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP+A++R+IGFDN+RQVQC+SFI KPPG Sbjct: 146 ECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 62.0 bits (149), Expect = 4e-10 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E KKEYP A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 144 ECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 61.2 bits (147), Expect = 6e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 KKEYP+A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 150 KKEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 60.8 bits (146), Expect = 8e-10 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN RQVQC+SFIA+KP G Sbjct: 146 ECKKEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 60.8 bits (146), Expect = 8e-10 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E KKEYP+A +RIIGFDN RQVQC+SFIA+KPP Sbjct: 144 ECKKEYPNALIRIIGFDNNRQVQCISFIAYKPP 176
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YPDA++RIIGFDN+RQVQC+SFIA+KP Sbjct: 146 EAKKAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A+VRIIGFDN+RQVQC+SFIA+KP G Sbjct: 147 EAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQCVSFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP+A++RIIGFD+ RQVQCVSFIA+KP G Sbjct: 146 ECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN RQVQCVSFIA+KP G Sbjct: 148 EAKKAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 147 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 147 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E K EYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 144 ECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 147 ECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E K EYP+A++RIIGFDN RQVQC+SFIA+KPP Sbjct: 144 ECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 144 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 144 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 60.1 bits (144), Expect = 1e-09 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E K YP+ ++RIIGFDN+RQVQC+SFIA+KPPG Sbjct: 144 EAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 147 EAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 150 EAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E+ K +PD Y RIIGFDN+RQVQC+SF+A+KPPG Sbjct: 148 ELIKHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+A++RIIGFDN+RQVQCVSFIA+KP Sbjct: 146 EAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 59.7 bits (143), Expect = 2e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+SFIA KP G Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 EAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP +++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 149 EAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 147 EAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 146 EAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 59.3 bits (142), Expect = 2e-09 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E K YP+A++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 144 EAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 223 E+ K YPD Y RIIGFDN+RQVQC+SF+A+KP G E Sbjct: 148 EMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKGAE 183
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 58.5 bits (140), Expect = 4e-09 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 223 E K YPDA+ R+IGFDN++Q QCVSFIA+KPPG + Sbjct: 135 EAIKSYPDAFHRVIGFDNIKQTQCVSFIAYKPPGSD 170
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KK YP A++RIIGFDN RQVQ +SFIA+KPPG Sbjct: 148 ECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+A+ RIIGFDN+RQVQC+SFIA+KP Sbjct: 144 EAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E K YP A++RIIGFDN+RQVQC+SFIA+KP G Sbjct: 147 EAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KKEYP A++RIIGFDN+RQVQC+SFIA KP Sbjct: 139 ECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP A++RIIGFDN+RQVQC+SFIA+KP Sbjct: 146 EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 57.8 bits (138), Expect = 7e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E K YPDA+VRIIGFDN RQVQC+SFIA+KP Sbjct: 145 ECKNAYPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 57.8 bits (138), Expect = 7e-09 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E K YP+ ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 144 EAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 57.8 bits (138), Expect = 7e-09 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E K YP+ ++RIIGFDN+RQVQC+SFIA+KPP Sbjct: 144 EAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 57.8 bits (138), Expect = 7e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP A++RIIGFDN RQVQCVSFIA+KP Sbjct: 149 EAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E KKEYP A++RIIGFDN+RQVQC+ FIA +P G Sbjct: 144 ECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 56.6 bits (135), Expect = 2e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 E K YP +++RIIGFDN RQVQC+SFIA+KPP Sbjct: 148 EASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 145 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK YP+ +VRIIGFDN RQVQC+SFIA+KP Sbjct: 141 EAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 55.8 bits (133), Expect = 3e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KKEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 55.8 bits (133), Expect = 3e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KKEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 55.8 bits (133), Expect = 3e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KKEYP A++R+IGFDN+RQVQCVSFI KP Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 54.7 bits (130), Expect = 6e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KKEYP A++R+IGFDN+RQVQCVSFI +P Sbjct: 147 ECKKEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 54.7 bits (130), Expect = 6e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E K EYP+A++RIIGFDN+RQVQC+SFIA P Sbjct: 144 ECKAEYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 54.3 bits (129), Expect = 7e-08 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 + K EYPD+++RIIGFDN+RQVQC+SFIA P Sbjct: 146 DCKAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 53.5 bits (127), Expect = 1e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 EVKK PDA+VR IGF++ R+VQC+SFIA+KP G Sbjct: 89 EVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 229 E K YPD + RIIGFDN RQVQC+SF+ +KP G Sbjct: 144 ECSKAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 52.8 bits (125), Expect = 2e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E K YP+A++R+IGFDN+RQVQC+SFI KP Sbjct: 155 ECAKAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E K YP A++R+IGFDN+RQVQC+SFI KP Sbjct: 139 ECAKAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 51.6 bits (122), Expect = 5e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 EV YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 146 EVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 51.6 bits (122), Expect = 5e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 EV YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 146 EVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 EV YP+A+VR+IGF+N+RQVQC+SFIA P Sbjct: 102 EVVAAYPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 47.8 bits (112), Expect = 7e-06 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E + EY D Y+R++GFDN++Q Q VSFI +KP Sbjct: 75 ECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 47.0 bits (110), Expect = 1e-05 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E + EYP+ Y+R++GFDN++Q Q VSFI KP Sbjct: 75 ECRTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E + E P+ Y+R+IGFDN++Q Q VSFI KP Sbjct: 75 ECRSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E + EY D Y+R+ GFDN++Q Q VSFI +P Sbjct: 76 ECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 42.7 bits (99), Expect = 2e-04 Identities = 14/30 (46%), Positives = 26/30 (86%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 K+++P+AY+R++ FD++RQVQ + F+ +KP Sbjct: 76 KQQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 1091 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 803 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 660 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 516 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 373 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 229 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 E ++ YP YVR+ FD+++QVQ +SF+ +P Sbjct: 1235 ECRRAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEES 217 E ++ YP YVR+ FD+++QVQ +SF+ +P G S Sbjct: 948 ECRRAYPQCYVRL-AFDSVKQVQVISFVVQRPSGSSSS 984
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 42.0 bits (97), Expect = 4e-04 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 + +YP Y+R++GFDN++Q Q +SFI KP Sbjct: 77 RSQYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 40.8 bits (94), Expect = 9e-04 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAYVR++ FDN +QVQ + F+ +P + Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRPKSARD 176
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 K +PDAYVR++ FDN +QVQ + F+ +P Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 40.0 bits (92), Expect = 0.001 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = -1 Query: 315 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 +P+ Y+R++ FDN++QVQC+ F+ +P E Sbjct: 128 FPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 40.0 bits (92), Expect = 0.001 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 330 EVKKEY-PDAYVRIIGFDNMRQVQCVSFIAFKP 235 E KK Y Y+R +GFDN RQVQC SFI +P Sbjct: 146 ECKKLYGKKCYIRCLGFDNTRQVQCASFIVHQP 178
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 39.3 bits (90), Expect = 0.002 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 44 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 131 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 84 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 K +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 K +PDAY+R++ FD RQVQ F+ +PP Sbjct: 142 KAFPDAYIRLVCFDANRQVQISGFLVHRPP 171
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 37.7 bits (86), Expect = 0.007 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCE 223 E YP+ I+GFDN+RQ Q ++FIA+KP G E Sbjct: 134 EAIASYPELRA-ILGFDNIRQTQWLTFIAYKPAGSE 168
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -1 Query: 315 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -1 Query: 315 YPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEE 220 +PDAY+R++ FD RQVQ F+ +PP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 K +PDAY+R++ FD RQVQ F+ +P Sbjct: 133 KAFPDAYIRLVCFDANRQVQISGFLVHRP 161
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 ++ YPD +VR++G+D Q + SF+A +P Sbjct: 83 RRSYPDHHVRLVGYDTYAQSKGHSFLAHRP 112
>DPO1_BACST (P52026) DNA polymerase I (EC 2.7.7.7) (POL I)| Length = 876 Score = 31.6 bits (70), Expect = 0.52 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = -3 Query: 307 RLCPHHRIRQHASGAVRQLHRLQATRLRGVWQGLNKLTPFYHTTWFRA 164 +L PHH I +H RQL +LQ+T + G+ + ++ +T HT + +A Sbjct: 563 KLAPHHEIVEHILH-YRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQA 609
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 31.6 bits (70), Expect = 0.52 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKP 235 K+ P+ +++IG+DN+RQ Q + + ++P Sbjct: 93 KRSNPNHLIKLIGYDNIRQTQGTAMLVYRP 122
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFKPP 232 K +P +VR+IG+DN Q Q + + F+ P Sbjct: 87 KAHPSHHVRLIGYDNYAQSQGTAMVIFRGP 116
>RBS_SYNPX (P0A4S5) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 238 + YPD +VRI+G+D Q Q F+ F+ Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_SYNPW (P0A4S6) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.8 bits (68), Expect = 0.88 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 238 + YPD +VRI+G+D Q Q F+ F+ Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVFE 111
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 238 +E+PD VR + +DN Q Q ++F+ ++ Sbjct: 81 REFPDQMVRFVAYDNYAQSQGMAFVVYR 108
>RBS_GUITH (P14960) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 139 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQ--CVSFIAFKPPGCE 223 +K P YV++ FDN R V+ C+SFI +P E Sbjct: 72 RKAKPACYVKVNAFDNSRGVESCCLSFIVQRPTSNE 107
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 238 K P +VRI+G+DN +Q Q S + ++ Sbjct: 87 KRNPHNHVRIVGYDNFKQSQGTSLVVYR 114
>PCD10_HUMAN (Q9P2E7) Protocadherin-10 precursor| Length = 1040 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = -2 Query: 212 RPKQANSLLSYNMVSCQVHFISLFTFV 132 R + AN+ L+Y+++ CQ+ +S+FT+V Sbjct: 490 RDEGANAQLAYSILECQIQGMSVFTYV 516
>RBS_PORAE (Q09125) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 324 KKEYPDAYVRIIGFDNMRQVQ--CVSFIAFKP 235 +K P+ Y+++ FDN R V+ C+SFI +P Sbjct: 72 RKAKPNYYIKVNAFDNTRGVESCCLSFIINRP 103
>RN139_HUMAN (Q8WU17) RING finger protein 139 (Translocation in renal carcinoma| on chromosome 8) Length = 664 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 153 YFPFYFCSACVCVLSLQLELTLYEYYNHKSTTTTFG*GACKLRLCIK 13 +FP F SAC+ +L + L L+ +Y T F A + LC+K Sbjct: 389 HFPVLFVSACLFILPVLLSYVLWHHY--ALNTWLFAVTAFCVELCLK 433
>RN139_MOUSE (Q7TMV1) RING finger protein 139| Length = 668 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -1 Query: 153 YFPFYFCSACVCVLSLQLELTLYEYYNHKSTTTTFG*GACKLRLCIK 13 +FP F SAC+ +L + L L+ +Y T F A + LC+K Sbjct: 389 HFPVLFVSACLFILPVLLSYVLWHHY--ALNTWLFAVTAFCVELCLK 433
>DPO1_BACCA (Q04957) DNA polymerase I (EC 2.7.7.7) (POL I)| Length = 877 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = -3 Query: 307 RLCPHHRIRQHASGAVRQLHRLQATRLRGVWQGLNKLTPFYHTTWFRA 164 +L P+H I ++ RQL +LQ+T + G+ + + T HT + +A Sbjct: 563 KLAPYHEIVENILQHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQA 610
>RBS2_HYDMR (Q59461) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 122 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG-CEESG 214 + + YP+ +R+IG+DN Q Q +F F G C G Sbjct: 79 QCRAAYPNHMIRLIGYDNYTQCQGHNFCRFTVLGECNSHG 118
>RBS_BRAJA (Q9ZI33) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 134 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCV--SFIAFKPP 232 E ++ Y D Y+RI GFD+ + V SF+ +PP Sbjct: 70 ECRRVYGDRYIRISGFDSSPGWESVRISFLVNRPP 104
>ZN268_HUMAN (Q14587) Zinc finger protein 268 (Zinc finger protein HZF3)| Length = 947 Score = 28.1 bits (61), Expect = 5.7 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = -1 Query: 240 KPPGCEESGKA*TS*LPFIIQHGFVPGSFYFPFYFCSACVCVLSLQLELTLYE 82 KP C E GKA T I+ G G Y CS C SL+ +L +++ Sbjct: 638 KPYSCNECGKAFTFKSQLIVHKGVHTG---VKPYGCSQCAKTFSLKSQLIVHQ 687
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 321 KEYPDAYVRIIGFDNMRQVQCVSFIAFK 238 K +P+ +VR+IGFDN Q + + ++ Sbjct: 86 KAHPNNHVRLIGFDNYAQSKGAEMVVYR 113
>RBS1_RHOSH (P27998) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 129 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQCV--SFIAFKP 235 E +K +P Y+RI FD+ R + V SFI +P Sbjct: 70 ECRKAWPGRYIRINAFDSTRGFETVTMSFIVNRP 103
>LGT_LACJO (P60971) Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)| Length = 278 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 189 FIIQHGFVPGSFYFPFYFCSACVCVLSLQLELTL 88 FIIQ ++ GS+Y P Y + + ++ L L L+L Sbjct: 161 FIIQQMYINGSYYQPTYLYESTLNLIGLILILSL 194
>VE6_HPV11 (P04019) Protein E6| Length = 150 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 150 FPFYFCSACVCVLSLQLELTLYEYYNHKSTTTT 52 FPF +AC C L LQ ++ Y ++N+ + T Sbjct: 59 FPF---AACACCLELQGKINQYRHFNYAAYAPT 88
>RBS_CYAME (O22024) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/34 (26%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = -1 Query: 330 EVKKEYPDAYVRIIGFDNMRQVQ--CVSFIAFKP 235 E +K++P+ Y++++ F++ + ++ +SFI +P Sbjct: 70 ECRKQFPNHYIKVLAFNSTKGIESTALSFIVNRP 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,763,553 Number of Sequences: 219361 Number of extensions: 719540 Number of successful extensions: 1657 Number of sequences better than 10.0: 135 Number of HSP's better than 10.0 without gapping: 1625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1656 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
