Clone Name | rbasd17k01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDP1_SCHPO (O13862) Transcriptional activator protein rdp1 (Rhp5... | 31 | 2.8 | 2 | ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disint... | 30 | 3.6 |
---|
>RDP1_SCHPO (O13862) Transcriptional activator protein rdp1 (Rhp51-DRE-binding| protein 1) Length = 478 Score = 30.8 bits (68), Expect = 2.8 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = +3 Query: 198 LNHRLLGTASAKAGVSDEVHLGGGLPHAHPFVRRPPAAAERDPDGGDHAVPRRDAHLA 371 LN L+ A + A VS + H H HPF R+P +A H++PR A A Sbjct: 299 LNSSLVDAAESLANVSQQQH------HRHPFARQPDYSA--------HSIPRTAAPYA 342
>ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1906 Score = 30.4 bits (67), Expect = 3.6 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 10/60 (16%) Frame = -3 Query: 219 CREACGSGSSSPLTDRLFIPDFQLKLPTQLELG-PPSLF---------DLTWFRPPWYGC 70 C + CG G S F P+ Q+ EL PPS+ D++W+R PW C Sbjct: 1366 CTQTCGGGVKSRFVICQF-PNGQMTQEHSCELPKPPSMMQCHLHACPEDVSWYRGPWKSC 1424 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,028,328 Number of Sequences: 219361 Number of extensions: 1262141 Number of successful extensions: 3213 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3212 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)