| Clone Name | rbasd17h19 |
|---|---|
| Clone Library Name | barley_pub |
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 32.0 bits (71), Expect = 1.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 69 CHRRCWQPGCSHPLCVLL*CCK 4 C C+QP C HP C + CC+ Sbjct: 46 CQSVCYQPTCCHPSCCISSCCR 67
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated| protein 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 30.4 bits (67), Expect = 3.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 69 CHRRCWQPGCSHPLCVLL*CCK 4 C C QP C HP C + CC+ Sbjct: 9 CQSVCCQPTCCHPSCCISSCCR 30 Score = 30.0 bits (66), Expect = 5.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 69 CHRRCWQPGCSHPLCVLL*CCK 4 C C QP C HP C + CC+ Sbjct: 44 CQSVCCQPTCCHPSCSISSCCR 65
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 30.4 bits (67), Expect = 3.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 69 CHRRCWQPGCSHPLCVLL*CCK 4 C C QP C HP C + CC+ Sbjct: 100 CQSVCCQPTCCHPSCCISSCCR 121
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 30.0 bits (66), Expect = 5.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 69 CHRRCWQPGCSHPLCVLL*CCK 4 C C QP C HP C + CC+ Sbjct: 125 CQSVCCQPTCCHPSCSISSCCR 146
>VGLM_PTPV (P03517) M polyprotein precursor [Contains: Nonstructural protein| NS-M; Glycoprotein G1; Glycoprotein G2] Length = 1313 Score = 30.0 bits (66), Expect = 5.1 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 306 GIIALLKWDLMCHIFPTSAVSIVHTVSYCPRLDGCKTEKCL 184 G++A + + H+ TS + VH V CP D C CL Sbjct: 651 GLLASVGGRIGIHLSHTSDSASVHMVVVCPPRDSCAAHNCL 691
>CBPA4_MOUSE (Q6P8K8) Carboxypeptidase A4 precursor (EC 3.4.17.-)| Length = 420 Score = 29.6 bits (65), Expect = 6.7 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +3 Query: 234 YVQCSQPMWGKCDTLNPILRELLCPSVDPNANKNEKSHRQNWQDHACCE 380 Y Q +W K + NP R C DPN N N + D+ C E Sbjct: 229 YTQSQNRLWRKTRSRNPGSR---CVGADPNRNWNASFAGEGTSDNPCSE 274
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 29.3 bits (64), Expect = 8.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 219 GSKTQYVQCSQPMWG-KCDTLNPILRELLCP 308 G T C+QP WG +C+ + REL CP Sbjct: 1269 GGLTFTCHCAQPFWGPRCERVARSCRELQCP 1299
>GLMU_LACAC (Q5FMG0) Bifunctional protein glmU [Includes:| UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)] Length = 459 Score = 29.3 bits (64), Expect = 8.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 485 NSLTRLRKTAEKSDKENKQECGPQSHVR 402 N++T T EKS+ E+ + GP SH+R Sbjct: 305 NNVTVTSSTIEKSEMEDNTDIGPNSHLR 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,507,259 Number of Sequences: 219361 Number of extensions: 1377317 Number of successful extensions: 4049 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4040 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)