Clone Name | rbasd16o15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KCND1_HUMAN (Q9NSA2) Potassium voltage-gated channel subfamily D... | 31 | 3.4 | 2 | RS8_ORYSA (P49199) 40S ribosomal protein S8 | 30 | 5.8 | 3 | DOT1L_DROME (Q8INR6) Histone-lysine N-methyltransferase, H3 lysi... | 30 | 7.6 |
---|
>KCND1_HUMAN (Q9NSA2) Potassium voltage-gated channel subfamily D member 1| (Voltage-gated potassium channel subunit Kv4.1) Length = 647 Score = 30.8 bits (68), Expect = 3.4 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 Query: 291 MLSPWRRPHRPQQRSRLTPPSHGQRHVNADPRRLVTTL 178 ML+ RR H PQ RS L H +N D R V + Sbjct: 561 MLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAI 598
>RS8_ORYSA (P49199) 40S ribosomal protein S8| Length = 220 Score = 30.0 bits (66), Expect = 5.8 Identities = 21/81 (25%), Positives = 29/81 (35%), Gaps = 5/81 (6%) Frame = +2 Query: 56 ITHYTASSXAWKPKLTSPILCCTQPXMKRNRSSKNAIHVQNRVVTNRLGSAFTCLWPWDG 235 +THY K + P CC Q +K + HV ++ + G Sbjct: 115 LTHYGVDIGRKKKEPPHPRGCCGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQF 174 Query: 236 GVSRDLCC-----GRCGRRHG 283 G R L C G+CGR G Sbjct: 175 GSGRLLACISSRPGQCGRADG 195
>DOT1L_DROME (Q8INR6) Histone-lysine N-methyltransferase, H3 lysine-79 specific| (EC 2.1.1.43) (Histone H3-K79 methyltransferase) (H3-K79-HMTase) (Protein grappa) (DOT1-like protein) (dDOT1L) Length = 1848 Score = 29.6 bits (65), Expect = 7.6 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -2 Query: 300 RSTMLSPWRRPHRPQQRSRLTPPSHGQRHVNA 205 RS+ L+P ++P RP + + PP+ Q+H +A Sbjct: 1635 RSSPLAPHQQPPRPSKLAHYEPPTTQQQHAHA 1666 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,934,630 Number of Sequences: 219361 Number of extensions: 1761315 Number of successful extensions: 4465 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4464 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)