| Clone Name | rbasd17d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HMCS2_PIG (O02734) Hydroxymethylglutaryl-CoA synthase, mitochond... | 32 | 1.7 | 2 | Y1717_CORDI (Q6NG17) UPF0054 protein DIP1717 | 31 | 2.8 | 3 | RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain... | 30 | 3.7 | 4 | LAMA1_HUMAN (P25391) Laminin alpha-1 chain precursor (Laminin A ... | 30 | 3.7 |
|---|
>HMCS2_PIG (O02734) Hydroxymethylglutaryl-CoA synthase, mitochondrial| precursor (EC 2.3.3.10) (HMG-CoA synthase) (3-hydroxy-3-methylglutaryl coenzyme A synthase) Length = 508 Score = 31.6 bits (70), Expect = 1.7 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 270 NLKCSCIYKCLESMLSQCCLSCAEFTPIGCFALGS 374 N+ S +Y CL S+LSQC + IG F+ GS Sbjct: 380 NMYTSSLYGCLASLLSQCSAQDLAGSRIGAFSYGS 414
>Y1717_CORDI (Q6NG17) UPF0054 protein DIP1717| Length = 196 Score = 30.8 bits (68), Expect = 2.8 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 121 HELALLPTYNCLHILG 74 HELALL T+ CLH+LG Sbjct: 112 HELALLTTHGCLHLLG 127
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 30.4 bits (67), Expect = 3.7 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 6/90 (6%) Frame = +3 Query: 105 SSANSCSVRPHMG-RSGLALDMAKQEQ*IFSHLSKHVRRYAC*TKTRPQSMGKF-----F 266 S A S V P G +S A + ++ SHL + R C + + KF Sbjct: 17 SPAQSSMVAPFTGLKSASAFPVTRKPNADLSHLPSNGGRVQCMKVWPIEGVKKFETLSYL 76 Query: 267 PNLKCSCIYKCLESMLSQCCLSCAEFTPIG 356 P +K + K +E +L + C EF P G Sbjct: 77 PTMKDEALVKQIEYLLRSKWIPCLEFCPKG 106
>LAMA1_HUMAN (P25391) Laminin alpha-1 chain precursor (Laminin A chain)| Length = 3075 Score = 30.4 bits (67), Expect = 3.7 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -2 Query: 556 SCMDSQCAKGPCICKEAADGTL--RIEPEVYSESLSRSVMVQVNSHGQSIFFCF 401 S D C GPC+CKE +G R +P Y+ + + N G S FCF Sbjct: 461 SASDEPCT-GPCVCKENVEGKACDRCKPGFYN-------LKEKNPRGCSECFCF 506 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,982,277 Number of Sequences: 219361 Number of extensions: 1595041 Number of successful extensions: 3419 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3419 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)