Clone Name | rbasd16n21 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | QORH_ARATH (Q9SV68) Putative chloroplastic quinone-oxidoreductas... | 54 | 2e-07 | 2 | QORH_SPIOL (Q8H0M1) Chloroplastic quinone-oxidoreductase homolog... | 45 | 8e-05 | 3 | RT4I1_MOUSE (Q924D0) Reticulon-4-interacting protein 1, mitochon... | 31 | 1.6 | 4 | RT4I1_HUMAN (Q8WWV3) Reticulon-4-interacting protein 1, mitochon... | 30 | 2.7 |
---|
>QORH_ARATH (Q9SV68) Putative chloroplastic quinone-oxidoreductase homolog (EC| 1.-.-.-) Length = 329 Score = 53.9 bits (128), Expect = 2e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 489 LLKEGKLKTVIDSRFPLSDAGKAWQSSXDGHATGK 385 L+KEGK+KTVIDS+ PLS A AW S DGHATGK Sbjct: 290 LVKEGKVKTVIDSKHPLSKAEDAWAKSIDGHATGK 324
>QORH_SPIOL (Q8H0M1) Chloroplastic quinone-oxidoreductase homolog (EC 1.-.-.-)| (ceQORH) Length = 329 Score = 45.4 bits (106), Expect = 8e-05 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -3 Query: 489 LLKEGKLKTVIDSRFPLSDAGKAWQSSXDGHATGK 385 L+KE KLKTVIDS+ PLS AW GHATGK Sbjct: 290 LVKEKKLKTVIDSKHPLSKGEDAWSRIMGGHATGK 324
>RT4I1_MOUSE (Q924D0) Reticulon-4-interacting protein 1, mitochondrial precursor| (NOGO-interacting mitochondrial protein) Length = 396 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 489 LLKEGKLKTVIDSRFPLSDAGKAWQSSXDGHATGK 385 L+ GK++ VI+ FP S+ +A+ GHA GK Sbjct: 356 LVDAGKIRPVIERTFPFSEVPEAFLKVERGHARGK 390
>RT4I1_HUMAN (Q8WWV3) Reticulon-4-interacting protein 1, mitochondrial precursor| (NOGO-interacting mitochondrial protein) Length = 396 Score = 30.4 bits (67), Expect = 2.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 489 LLKEGKLKTVIDSRFPLSDAGKAWQSSXDGHATGK 385 L+ GK++ VI+ FP S +A+ GHA GK Sbjct: 356 LVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK 390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,993,063 Number of Sequences: 219361 Number of extensions: 1045931 Number of successful extensions: 2184 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2183 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)