| Clone Name | rbasd16m08 |
|---|---|
| Clone Library Name | barley_pub |
>CRSP7_HUMAN (O95402) CRSP complex subunit 7 (Cofactor required for Sp1| transcriptional activation subunit 7) (Transcriptional coactivator CRSP70) (Activator-recruited cofactor 70 kDa component) (ARC70) Length = 600 Score = 30.8 bits (68), Expect = 4.3 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -3 Query: 705 GVRADRAGAQRRRPWRG*PRDQLSEPGSPENILLLPHDPGVPD 577 G R DR G+++RR G RD PG P + HDP VP+ Sbjct: 138 GQRLDRLGSRKRR---GDQRD-FGHPGPPPKVSKASHDPLVPN 176
>TOP1_MYCLE (O69548) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 947 Score = 30.8 bits (68), Expect = 4.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 701 YVLTVLAPNDEGHGAADHGTS*ASPGRRRTS 609 YV VL +D+ +GAAD GT GRR ++ Sbjct: 729 YVTEVLPKHDDDYGAADQGTKKTKKGRRASA 759
>ELAV_DROME (P16914) Protein elav (Embryonic lethal abnormal visual protein)| Length = 483 Score = 29.6 bits (65), Expect = 9.5 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -1 Query: 704 GYVLTVLAPNDEGHGAADHGTS*ASPGRRRTSFYYHMIPEYQTEESMYNAVRRFGKVR 531 G +L V+ PN G AA T + PG F Y++ PE + E +++ FG V+ Sbjct: 373 GDMLDVMLPNGLGAAAAAATTLASGPGGAYPIFIYNLAPETE-EAALWQLFGPFGAVQ 429
>ELAV_DROVI (P23241) Protein elav (Embryonic lethal abnormal visual protein)| Length = 519 Score = 29.6 bits (65), Expect = 9.5 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -1 Query: 704 GYVLTVLAPNDEGHGAADHGTS*ASPGRRRTSFYYHMIPEYQTEESMYNAVRRFGKVR 531 G +L V+ PN G AA T + PG F Y++ PE + E +++ FG V+ Sbjct: 409 GDMLDVMLPNGLGAAAAAATTLASGPGGAYPIFIYNLAPETE-EAALWQLFGPFGAVQ 465
>RREB1_HUMAN (Q92766) RAS-responsive element-binding protein 1 (RREB-1)| (Raf-responsive zinc finger protein LZ321) Length = 755 Score = 29.6 bits (65), Expect = 9.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 389 AVLLPEDDKKPATPVSTPERKAPAVTGSRKSKLRRGK 279 A P++ +P P S+PE +P G ++ +RG+ Sbjct: 188 ATTSPKESSEPPAPASSPEAASPTEQGPARTSKKRGR 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,152,748 Number of Sequences: 219361 Number of extensions: 1518159 Number of successful extensions: 4953 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4952 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7196276819 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)