Clone Name | rbasd16m05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FRDC_VIBCH (Q9KNS3) Fumarate reductase subunit C | 32 | 1.5 | 2 | SYFB_PROM9 (Q31AV5) Phenylalanyl-tRNA synthetase beta chain (EC ... | 30 | 5.7 | 3 | FRDC_VIBVY (Q7MGX5) Fumarate reductase subunit C | 30 | 7.4 | 4 | FRDC_VIBVU (Q8DCX3) Fumarate reductase subunit C | 30 | 7.4 | 5 | CD34_CANFA (Q28270) Hematopoietic progenitor cell antigen CD34 p... | 30 | 9.7 |
---|
>FRDC_VIBCH (Q9KNS3) Fumarate reductase subunit C| Length = 127 Score = 32.3 bits (72), Expect = 1.5 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = -2 Query: 674 RTAYLRRHXEAFWVDFGDFRFLHIKTKSCTLTYLGLQQLSLALENLVQLSSRKQKWIPYL 495 R Y+R +W D +RF ++ + L L++ L +LV+ Q W+ ++ Sbjct: 4 RKPYVREMKRTWWKDHPFYRFYMVREATVLPLILFTLFLTVGLGSLVKGPEAWQTWLDFM 63 Query: 494 SSPLLL 477 ++PL++ Sbjct: 64 ANPLVI 69
>SYFB_PROM9 (Q31AV5) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 814 Score = 30.4 bits (67), Expect = 5.7 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -2 Query: 632 DFGDFRFLH----IKTKSCTLTYLGLQQLSLALENLVQLSSRKQKWIP 501 D G F +H ++ KS + YL S+ ++NL+ S+RK KWIP Sbjct: 671 DAGYFGEIHPKLILEKKSLKIVYL----FSINVDNLLGASTRKNKWIP 714
>FRDC_VIBVY (Q7MGX5) Fumarate reductase subunit C| Length = 127 Score = 30.0 bits (66), Expect = 7.4 Identities = 15/66 (22%), Positives = 33/66 (50%) Frame = -2 Query: 674 RTAYLRRHXEAFWVDFGDFRFLHIKTKSCTLTYLGLQQLSLALENLVQLSSRKQKWIPYL 495 R Y+R +W D +RF ++ + L L++ L +LV+ Q W+ ++ Sbjct: 4 RKPYVREVKRTWWKDHPFYRFYMLREATVLPLILFTLFLTVGLGSLVKGPEAWQTWLNFM 63 Query: 494 SSPLLL 477 ++P+++ Sbjct: 64 ANPVVI 69
>FRDC_VIBVU (Q8DCX3) Fumarate reductase subunit C| Length = 127 Score = 30.0 bits (66), Expect = 7.4 Identities = 15/66 (22%), Positives = 33/66 (50%) Frame = -2 Query: 674 RTAYLRRHXEAFWVDFGDFRFLHIKTKSCTLTYLGLQQLSLALENLVQLSSRKQKWIPYL 495 R Y+R +W D +RF ++ + L L++ L +LV+ Q W+ ++ Sbjct: 4 RKPYVREVKRTWWKDHPFYRFYMLREATVLPLILFTLFLTVGLGSLVKGPEAWQTWLNFM 63 Query: 494 SSPLLL 477 ++P+++ Sbjct: 64 ANPVVI 69
>CD34_CANFA (Q28270) Hematopoietic progenitor cell antigen CD34 precursor| Length = 389 Score = 29.6 bits (65), Expect = 9.7 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 7 NSSVQIYKSLCISLSLTGSNAHKFAVTMEP 96 NSSVQ SL I++S T +N +VT+EP Sbjct: 107 NSSVQSQTSLAITVSFTPTNFSTSSVTLEP 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,333,413 Number of Sequences: 219361 Number of extensions: 1944225 Number of successful extensions: 5108 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5107 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7309604013 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)