Clone Name | rbasd17a24 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CRYD_SYNY3 (P77967) Cryptochrome DASH | 29 | 5.5 | 2 | RL22_MYCPN (P75575) 50S ribosomal protein L22 | 29 | 5.5 |
---|
>CRYD_SYNY3 (P77967) Cryptochrome DASH| Length = 489 Score = 29.3 bits (64), Expect = 5.5 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +3 Query: 255 PSFFCG*STAPDMLKPEPNLKSDAPEMPPIWFPNCGVSSR 374 P FF AP L P PN+K + PP +FP R Sbjct: 173 PCFF-----APSQLLPSPNIKLELTAPPPEFFPQINFDHR 207
>RL22_MYCPN (P75575) 50S ribosomal protein L22| Length = 159 Score = 29.3 bits (64), Expect = 5.5 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = -1 Query: 202 LKCQLLVAKPTLCFHGKVSSSPKKWVILYRSSLNFHIGFAVVANRLELGTGYIYMYVHPA 23 L CQL+V K T +S++PKK L LN I A + + Y++ V Sbjct: 19 LVCQLIVGKKTADAQNILSNTPKKAATLIAKLLNSAIANATNNHGMNGDALYVFECVANQ 78 Query: 22 GEPLXKT 2 G + +T Sbjct: 79 GPSMKRT 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,767,488 Number of Sequences: 219361 Number of extensions: 805742 Number of successful extensions: 2087 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2087 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)