Clone Name | rbasd16l01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COX1_COREF (Q8FMT1) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 30 | 6.9 |
---|
>COX1_COREF (Q8FMT1) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Cytochrome aa3 subunit 1) Length = 580 Score = 30.0 bits (66), Expect = 6.9 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +2 Query: 347 LSCFGFWIVKTGFCGAITTLGPLSLGITSD*APTMFSATSDS 472 L+ FGFWI G G G L+ G +D TM+S SDS Sbjct: 122 LNAFGFWITTVG--GVAMLAGFLTPGGAADFGWTMYSPLSDS 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,678,727 Number of Sequences: 219361 Number of extensions: 1759477 Number of successful extensions: 4104 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4104 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)